KEGG   Prevotella ruminicola: PRU_1610Help
Entry
PRU_1610          CDS       T01212                                 

Definition
(GenBank) glycosyltransferase, group 2 family
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
pru  Prevotella ruminicola
Pathway
pru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pru01003]
    PRU_1610
Enzymes [BR:pru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     PRU_1610
Glycosyltransferases [BR:pru01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   PRU_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ADE81515
UniProt: D5ETF2
LinkDB All DBs
Position
1935883..1936632
Genome map
AA seq 249 aa AA seqDB search
MKQSDSIVIIPTYNEKENIEKIIRAIFGLEKSFHILVIDDGSPDGTAAIVRSLMSNEFGG
QLHLVERSGKLGLGTAYIAGFKWALERDYEYIFEMDADFSHDPNDLPRLYAACKDEGYDV
AIGSRYVSGVNVVNWPIGRVLMSYFASKYVRLVTGFNVHDTTAGFKCYKRRVLQTIELDK
IRFKGYAFQIEMKYTAYKIGFKIKEVSVIFVNRQEGVSKMSGGIFGEAFFGVMKLRWDGW
TRRYPKIEN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaagcgatagtatagttatcataccaacctataatgagaaggagaatatcgag
aagattatacgcgcgatattcgggttggagaagagtttccatatactggtgatcgacgat
ggatcgcctgatggtacggctgccattgtgcgtagcctgatgtccaatgagtttggcgga
cagctgcacctggtggagcgtagcggcaaactgggactgggaacagcttacattgccgga
tttaagtgggcactggagcgcgactacgaatacatatttgagatggacgccgactttagt
cacgacccgaacgacttgccacgactgtatgcggcctgcaaagacgagggctacgatgtg
gctatcggtagccgttacgtgagcggtgtgaacgtggttaactggcctatcggacgtgtg
ctgatgagttactttgcatcgaaatacgtgcgcttggtaacgggctttaacgtacacgac
accactgcaggatttaagtgctacaagcgccgtgtgctgcagaccatcgaactggataag
atccgattcaagggctatgccttccagatagaaatgaagtacactgcctacaagattggc
tttaagatcaaggaggtgagcgtgatattcgtgaaccgacaggagggcgtgagcaagatg
agcggtggcatattcggcgaggcattctttggcgtgatgaaactgcgctgggacggatgg
acgagacgatatccgaaaattgaaaattga

DBGET integrated database retrieval system