KEGG   Prevotella ruminicola: PRU_1894
Entry
PRU_1894          CDS       T01212                                 

Definition
(GenBank) putative CDP-diacylglycerol--serine O-phosphatidyltransferase
  KO
K17103  CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
pru  Prevotella ruminicola
Pathway
pru00260  Glycine, serine and threonine metabolism
pru00564  Glycerophospholipid metabolism
pru01100  Metabolic pathways
pru01110  Biosynthesis of secondary metabolites
Module
pru_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PRU_1894
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PRU_1894
Enzymes [BR:pru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     PRU_1894
SSDB
Motif
Pfam: CDP-OH_P_transf EIIC-GAT
Other DBs
NCBI-ProteinID: ADE82483
UniProt: D5EU74
LinkDB
Position
complement(2282469..2283155)
AA seq 228 aa
MFKKHIPNTITCCNLISGCIATLYAFEANFDMALLFIIIGAVFDFFDGMSARLLGVSSPI
GKELDSLADDITFGFAPSAIVFSYLCTFHTHLVWMPYLAFVMAAFSALRLAKFNLDERQA
LGFIGLPTPANALFWGSLVCGLTEYEVAFDGLEWIILVGTFISCYLLIAEIPMFALKFKH
WGWKGNEIKYVFVLSCVPLLLLLGVSGFAAIIAWYVVLSEFANVTKKK
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtttaagaagcatatccctaacacgataacctgctgcaaccttatttcgggctgcata
gcaacgctgtacgccttcgaggctaactttgatatggcgctgctgtttatcatcatcggt
gctgtattcgatttctttgatggcatgagtgcccgtttgctgggtgtttcatcgcctatc
ggtaaggagctcgattcgctggccgacgatatcacctttggctttgccccatcggctatc
gtgttcagttatctttgcaccttccacacccacttggtttggatgccttacctggcattt
gtgatggctgctttctcggccttgcgactggccaagtttaatctcgatgagcgccaggca
ttaggctttatcggtctgcccacacctgccaacgcgctgttctggggttcgctggtttgc
ggacttaccgagtacgaggtagcctttgatggtttggagtggattattctggttggaacc
tttatcagctgttatctgctgattgctgagatacctatgtttgccctcaagtttaagcac
tgggggtggaaaggcaacgagattaagtacgtgtttgtactctcgtgtgtacccttgtta
ctcctgttgggagtaagcggctttgcggccatcattgcatggtacgtagtgctgtcggag
tttgctaatgtaactaaaaagaagtaa

DBGET integrated database retrieval system