KEGG   Prevotella ruminicola: PRU_1913
Entry
PRU_1913          CDS       T01212                                 

Gene name
ribBA
Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pru  Prevotella ruminicola
Pathway
pru00740  Riboflavin metabolism
pru00790  Folate biosynthesis
pru01100  Metabolic pathways
pru01110  Biosynthesis of secondary metabolites
pru01240  Biosynthesis of cofactors
Module
pru_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pru00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PRU_1913 (ribBA)
   00790 Folate biosynthesis
    PRU_1913 (ribBA)
Enzymes [BR:pru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     PRU_1913 (ribBA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     PRU_1913 (ribBA)
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-ProteinID: ADE82552
UniProt: D5EU90
LinkDB
Position
2304268..2305470
AA seq 400 aa
MKLNSIEEAVKDFEQGEFVIVVDDEDRENEGDLIIAAEKITAEKVNFMLKHARGVLCAPI
TIERCKELDLPHQVQDNTSVLGTPFTVTVDKLEGCTTGVSAHDRAETIKALADPTSKAET
FGRPGHVNPLYAQDNGVLRRSGHTEAAIDLCRMAGLYPAGALMEIMNEDGTMARMPELMA
FAKEWNLKIISIKDMIAYRLKKESLIEVGEEVDMPTDYGHFRLIPFRQKSNGLEHMALIK
GEWKEDEPILVRVHSSCMTGDILGSKRCDCGEQLHKAMQAIEKEGKGVVIYMQQEGRGIG
LMNKIAAYKLQEEGLDTVDANVHLGFKPDERDYGCGAQMLRHIGVHKMRLLTNNPVKRVG
LEAYGLEIIENVPIEVTPNQYNLRYLETKKNRMGHTLHLK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgaagttgaacagcatagaagaggccgtaaaggacttcgagcagggtgagttcgtaatt
gtagtggatgatgaagaccgcgagaacgagggcgacctgattatcgctgccgagaagatt
acagcagagaaagtgaacttcatgttgaaacatgcacgtggtgtgctctgcgctcccatc
accattgagcgatgcaaggagctcgacctgccacatcaggtgcaggacaacacctcggtt
ctgggtacaccctttaccgttacagtcgacaaactggagggttgcaccacaggtgtaagt
gcccacgaccgtgccgaaaccatcaaggcactggccgacccaacatcaaaagccgagaca
ttcggacgcccaggacatgtaaatcctctttacgcccaggacaacggtgtgctgcgtcgt
agtggacataccgaagccgccatcgatctgtgtcgtatggcaggactctatcctgcaggt
gcactgatggagattatgaacgaggatggtaccatggcccgtatgcccgagctcatggcc
tttgccaaggagtggaatctgaagattatcagcattaaagatatgattgcctaccgactg
aagaaggaatcgctgattgaggtgggcgaagaggtggacatgccaaccgactacggtcac
ttccgcctgatccccttccgtcagaagagcaacggtctggagcacatggcgctgattaag
ggcgaatggaaggaggacgagcccatcctggtacgcgtacactcatcgtgtatgactggc
gacatcctgggcagcaagcgctgcgactgtggtgagcagctgcacaaggccatgcaggcc
atcgagaaagagggcaagggcgtggtgatctacatgcagcaggaaggtcgtggtatcggc
ttgatgaacaagattgccgcctacaagcttcaggaagagggactggacaccgtggatgcc
aacgtgcacttaggctttaagcccgacgagcgcgactatggttgcggtgcccagatgctg
cgccacatcggtgtgcacaagatgcgcctgcttaccaacaaccccgtgaaacgcgtggga
ttggaggcatacggccttgagattatcgagaacgtacccatcgaggttacccccaaccag
tacaatctgcgttatctggagaccaagaagaaccgtatgggacatacgctccacctgaaa
taa

DBGET integrated database retrieval system