KEGG   Prevotella ruminicola: PRU_2750Help
Entry
PRU_2750          CDS       T01212                                 

Gene name
susB
Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pru  Prevotella ruminicola
Pathway
pru00500  Starch and sucrose metabolism
pru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PRU_2750 (susB)
Enzymes [BR:pru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PRU_2750 (susB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C LemA
Motif
Other DBs
NCBI-ProteinID: ADE83522
UniProt: D5EY34
LinkDB All DBs
Position
complement(3392329..3394542)
Genome map
AA seq 737 aa AA seqDB search
MKKLLLSLALLPLMAIAGNVKSPNGNIELKFSVDNTGRPVYEMTYKGRAVIKPSHLGLEL
AKDRHSSKWTNETDLMDGFAIAKEETSTFDETWQPVWGETKNIRNHYNELAVTLDQPSAK
RQMLIRFRVYDDGIGFRYEFPQQKELNYFLIEEERTEFAMAGDHTAWWLPGDYDTQEQET
QETKLSGIRARFNEAVNWYNSSVAVFSETGVQTSLQMKSDDGLYINIHEAACQDYATMHL
ELVDAQTKHLSQELKGFTNAYTPNPAPSRYPLPQPFTFVSHLTPDATGLKGAMQTPCNTP
WRTVMVSDDARDMLSNNLILNLNEPCKIEDTSWIHPTKYCGVWWEMIVGKSSWNYTDEYP
SIKLDQIDWNKVKPNGRHGANNEKVKRYIDFAAKNGLDEVLVEGWNVGWEDWANLWKRDV
FDFVTPYPDFDIKMLNDYAHSKGVKLLMHHETSSSTQNYERHMEQAFNLMNKYGYDAVKT
GYVGDIIPRGDHHYSQSMNNHYLYVVKEAAKHHIMVNAHEATRPTGLCRTWPNLVGNESA
RGTEYEAFGGSNPDHTCILPFTRLQGGPMDYTPGIFVTKLKEWSDNDSWARITIAGSLAL
YLTMYSPLQMAADLPENYEKFDDAFQFIRDVACDWDESIYLEAEPADYITVARKAKGTDN
WFIGGKCDENGHKSTIKLNFLDKGRKYDCTIYADAKDAHYEKNPQAYVITKKVVTAKDVL
KLTEAPGGGFAVSLIAK
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttactcttatcgctggctttgctgccactgatggccatcgccggcaatgtg
aaatcgcctaacggcaacattgaattaaagttttctgttgacaacactggtcgccctgtc
tatgagatgacctacaagggacgtgccgtcatcaagccttctcatctcggactggagctg
gctaaggaccgccactcatccaagtggaccaacgagaccgacctgatggacggcttcgct
atcgccaaggaagaaacctctaccttcgacgagacctggcagccagtatggggcgaaacc
aagaacattcgcaaccattacaacgaactggcagtaacgttggatcagccatcagctaag
cgccagatgctcatccgtttccgtgtctatgacgatggtatcggattccgttacgagttc
cctcagcagaaagagctcaactacttcctgattgaagaggaacgcacagagtttgccatg
gcaggcgatcacactgcctggtggctgcctggcgattacgacacccaggagcaggagaca
caagagaccaagctctctggcatacgtgcccgtttcaacgaggccgttaactggtataac
tcatcggtagccgtattctcagagactggcgttcagacttcgctccagatgaagagcgac
gatggactgtacatcaacatccacgaagcagcctgccaggattacgctacgatgcacctg
gagttggttgatgctcagaccaagcatctctcacaggagctgaaaggctttactaatgcc
tataccccaaatccggctccttcacgctatcctttgccacagcctttcaccttcgtgagc
caccttactcccgatgctacaggcttgaagggtgccatgcagacaccttgcaatacccct
tggcgcaccgtgatggtatcggatgatgcacgcgacatgctgtcgaacaacctcatcctg
aacctgaacgagccttgtaagattgaagacacctcatggatccaccccactaagtactgc
ggtgtatggtgggaaatgattgtgggcaagagctcatggaactataccgatgagtatccc
agcattaagctcgaccagatcgactggaacaaggtgaagcctaacggtcgtcatggtgcc
aacaacgagaaggtgaagcgttatatcgactttgcagccaagaacggcctcgacgaggta
ttggttgaaggttggaacgttggttgggaagactgggccaacctgtggaagcgcgacgtg
tttgacttcgtgaccccctatcctgatttcgacatcaagatgctcaacgactatgcccac
tctaagggtgtgaaactgctgatgcaccacgagacctcaagctctacccagaactacgag
cgccacatggaacaggctttcaacctgatgaacaaatacggctacgacgctgtgaagacc
ggttacgtgggtgacatcatccctcgtggcgaccatcactactcacagtcgatgaacaac
cactacctctatgtagtgaaagaggctgccaagcaccatatcatggtcaatgcccacgag
gcaacacgtcctacaggtctctgccgtacatggcctaacctcgttggtaacgagtcggct
cgcggcacagagtacgaggccttcggtggttctaaccccgatcacacctgcatcctgcca
ttcacccgtttgcagggcggtccgatggactacaccccaggtatcttcgtcaccaagctg
aaggagtggagcgacaacgactcttgggcacgcatcaccatcgccggttcgctggccctc
tatctcaccatgtactcaccattgcagatggctgccgacctgcccgaaaactacgagaag
ttcgacgatgccttccagttcatccgtgatgtggcttgcgactgggacgagagcatctac
ctggaggccgagcctgccgactatatcaccgtagcccgcaaggccaagggcaccgacaac
tggtttatcggtggcaaatgtgatgagaacggacacaagagcaccatcaaactcaacttc
ttagacaaaggtcgtaagtacgactgtaccatctatgccgatgccaaggatgctcactac
gagaagaatcctcaggcttatgtcatcaccaagaaggtggtaacagccaaggatgtgctt
aagctcacagaggctcctggtggaggtttcgccgtatcacttattgcaaaataa

DBGET integrated database retrieval system