KEGG   Propioniciclava sp. HDW11: G7070_00365
Entry
G7070_00365       CDS       T06483                                 

Definition
(GenBank) isoprenyl transferase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
prv  Propioniciclava sp. HDW11
Pathway
prv00900  Terpenoid backbone biosynthesis
prv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:prv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    G7070_00365
Enzymes [BR:prv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     G7070_00365
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: QIK73732
UniProt: A0A6G7YA84
LinkDB
Position
73501..74286
AA seq 261 aa
MPPTPHPSGATPPAIPAKFVPRHVAIVMDGNGRWAKERNLPRTDGHARGEASLLDTIHGA
VEIGVKYLSAYAFSTENWKRSPDEVRWLMGFNRDVIHRRRDELNDLGVRIVWAGREPRLW
KSVINELRVAEEMSRHNTTLTLQFCVNYGGRSEIVDAVRALAADAAAGRIDPDRISEKSL
TSRLYRPEVPDVDLFIRSSGEQRTSNFLLWQMAYAEMVFLDRLWPDFDRRDLWHAIELYA
QRDRRYGGAVPNQVQPRPDVS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgccgccgacgccgcacccgagcggcgccacaccgcccgcgatccccgcgaagttcgtg
ccccggcacgtcgccatcgtcatggacgggaacggccgctgggccaaggagcggaacctg
ccgcgcaccgacgggcacgcgcgcggcgaggcgtccctgctggacacgatccacggcgcg
gtcgagatcggcgtgaagtacctgtcggcgtacgcgttctccaccgagaactggaagcgg
tcccccgacgaggtgcgctggttgatgggcttcaaccgcgacgtcatccatcgccgccgc
gacgaactcaacgacctgggcgtgcggatcgtgtgggccggacgcgagccccggctgtgg
aagagcgtcatcaacgaactccgggtcgccgaggagatgagccgccacaacaccaccctg
acgctgcagttctgcgtcaactacggcggacgctcggagatcgtggacgccgtccgcgcg
ctggccgccgacgccgccgccgggcggatcgaccccgaccggatcagcgagaagtcgctg
acgtcgcggctgtaccgccccgaggtgccggacgtggacctgttcatccgtagctccggg
gagcagcgcacgtcgaacttcctgctctggcagatggcctacgccgagatggtgtttctg
gaccggctgtggcccgacttcgaccgccgcgacctgtggcacgccatcgagctgtacgcc
cagcgcgaccgccgctacggcggcgccgtccccaaccaggtccagccgcgccccgacgtc
tcatga

DBGET integrated database retrieval system