KEGG   Propioniciclava sp. HDW11: G7070_05815
Entry
G7070_05815       CDS       T06483                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
prv  Propioniciclava sp. HDW11
Pathway
prv00620  Pyruvate metabolism
prv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    G7070_05815
Enzymes [BR:prv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     G7070_05815
SSDB
Other DBs
NCBI-ProteinID: QIK71878
UniProt: A0A6G7Y5G1
LinkDB
Position
1191352..1194744
AA seq 1130 aa
MEAPSTAAINLRLALLGQPLVDADDLANDRTIAPLLARQREMSRRLSERLSPVDQRIQAF
LDDFLQGTSVSPELPRRTLVLDQPGMARELSLPVHGDEFSSELLSSYRLLNGVLHNPAND
RRTTAGVFHVAEGGLPIPDDKIAVDRDVAARIFAAAFDAPAEALRLPWSSAAAQPAECFV
SLLLRPTVVPGVEGVTTDKSLEVRFIVPGGMVANLDFVESIFGNAGDPYLPENDSSLDPE
HWTGHTGLVVLAPHLTALTKKELGMPHVSEATERQKRDGQCWETEDERYNGGSAFKLCLR
DARGVIATVIADNYFGYCKKEVKTQISYSANLYGNAEEEHAGGAVVFPAYNLGTEWTDDR
TPEGYTLADVVARDPEAFEVHPEGHATVVAWPHITVVPRGATFSMREQSITWGDGEDRRT
IKLLADHTYMTPSGYRVHAKHRETDQRQWHLVGTSSTPTHCHKPATVSGGGKSEISKSIL
DAFVFGSVFTADFGADMDQVQALIDRDYSERFADAGRNGTDHRGILSPERSLGSVIKLMT
TSRRFTAEHNAFLATIPEHVKELLFTVKRFYKPEWGTQWREHFSVMMLNGREGNEVRLDG
AEIVANYLRVGFEADGSWRLFSLRPDFSAAAKVQSEDDITASTVVPGSAVPASDVPAELS
RKIVQNCERLLFQRPDDAIHRGYDKQTEKDMAREGTFISNFQPLTHDDARAMVEDVQAQS
EFTEPMADLIEKAASLPQDASPEYFVCSAEPRIVNGKRSKNPRYLQVRPDLSNPDATASA
DVSLHLLRQVSLAEQCPAPVDVVAAGRRNNAAEPGVPPLCTYNPLHYMELPELFMEFISS
MTGKSPSTTGAGSEGAMTKGPFNALPAIFDLNAAFLSFALTGYDGWLSSAGTIGPRMRID
HDFSLLVPEVFSRMTPKERDAATLIEQGYLERLTDFEHDGEQVLASRLGYRMNEAFATQF
FGRIFLHPDVVFTSEMLKPETQDLDTFATSMATIVKTHQRVAQAYFDDGTISEAIPPLRG
LLEIMATGTTADGLTLDDAAFRDQFTRDAVLAADWYAARLDAKRDEDLAHQERSAHDLRH
FLGQEANAEAAERLGLAERLAEIEEAIEAMSGQEYRDSLVGTIGRQPLSR
NT seq 3393 nt   +upstreamnt  +downstreamnt
atggaagctccgtcgaccgccgccatcaacctccgcctcgctctgctgggtcagcccctc
gtggacgccgacgacctggccaacgaccgcaccatcgccccgctcctggcgcggcagcgc
gagatgtcccgccgcctgtccgagcgcctcagccccgtcgatcagcgcatccaggcgttc
ctggacgacttcctgcagggaacgtcggtctcccccgaactcccccgccgcaccctcgtg
ctcgaccagccgggcatggcgcgcgagttgtcgctgccggtgcacggcgacgagttcagc
tccgaactgctgtcgagctaccggctgctgaacggcgtcctgcacaacccggccaacgac
cgccgcaccaccgcgggcgtgttccacgtcgccgagggcggcctgccgatccccgacgac
aagatcgcggtcgaccgcgacgtcgccgcccgcatcttcgcggccgcgttcgacgcgccg
gccgaggcgctgcgcctgccctggtcgtccgcggccgcccagcccgccgagtgcttcgtg
tcgctgctgctgcgtccgaccgtcgtccccggtgtggagggcgtcacgaccgacaagtcg
ctggaggtccgcttcatcgtgcccggcggcatggtcgccaacctcgacttcgtcgagtcg
atcttcggcaacgccggcgacccctacctgcccgagaacgactcctcgctcgaccccgag
cactggaccgggcacaccggcctggtggtgctggcgccgcacctgacggcgctcaccaag
aaggaactcgggatgccgcacgtgagcgaggccaccgagcgccagaagcgcgacgggcaa
tgctgggagaccgaggacgagcgctacaacggtggctcggccttcaagttgtgcctgcgc
gacgcccgcggcgtcatcgccaccgtgatcgcggacaactacttcgggtactgcaagaag
gaggtcaagacccagatctcctactccgccaacctctacggcaacgccgaggaggagcac
gccggcggcgccgtcgtcttcccggcttacaacctgggcaccgagtggaccgacgaccgg
actcccgagggctacacgctcgccgacgtcgtggcgcgcgacccggaggcgttcgaggtg
caccccgaggggcacgcgaccgtggtggcgtggccgcacatcacggtggtcccccgcggc
gcgaccttctcgatgcgcgagcagtccatcacctggggcgacggcgaggaccggcgcacc
atcaagctgctggccgaccacacctacatgacgccgagcggctatcgcgtgcacgccaag
caccgggagaccgatcagcggcagtggcacctcgtcggcacttcctcgacgccgacgcac
tgccacaagcccgcgacggtgtcgggcggcggcaagtccgagatcagcaagtcgatcctg
gacgccttcgtcttcgggtcggtgttcaccgccgacttcggggcggacatggaccaggtg
caggcgctgatcgaccgcgactactccgagcggttcgccgacgccggccgcaacgggacc
gaccaccgcggcatcctcagcccggagcgctcgctcggctcggtcatcaagctcatgacg
acctcgcgccgcttcacggccgaacacaacgcgttcctggccacgatccccgagcacgtc
aaggaactgctgttcaccgtcaagcggttctacaagcccgagtggggcacgcagtggcgc
gagcacttcagcgtcatgatgctcaacggccgcgagggcaacgaggtgcgcctcgacggc
gccgagatcgtcgccaactacctgcgcgtgggcttcgaggcggacggctcctggcggctg
ttctcgctgcgtccggacttctcggccgccgcgaaggtgcagtccgaggatgacatcacc
gcctccacggtcgtgccgggctcggcggtgccggcctcggacgtccccgccgaactgtcg
cgcaagatcgtgcagaactgcgagcggctgctgttccagcgtccggacgacgccatccac
cgcggctacgacaagcagaccgagaaggacatggcgcgcgagggcacgttcatctccaac
ttccagccgctgacccacgacgacgcccgcgcgatggtcgaggacgtccaggcgcagtcg
gagttcaccgagccgatggccgacctcatcgagaaggcggcgtccctgccccaggacgcg
tcgccggagtacttcgtgtgctccgccgagccccgcatcgtgaacggcaagcggtccaag
aacccgcgctacctgcaggtgcgccccgacctgtccaacccggacgccacggcgtccgcg
gacgtctcgctgcacctgctgcgccaggtgtcgctcgccgagcagtgccccgcgccggtg
gacgtggtggccgccggccgccgcaacaacgccgccgagccgggcgtgccgccgctgtgc
acgtacaacccgctgcactacatggagttgcccgagctgttcatggagttcatcagctcc
atgaccggcaagtcgccctccacgacgggcgcgggctccgagggcgccatgaccaagggc
ccgttcaacgcgctgccggcgatcttcgacctgaacgccgcgttcctgtcgttcgccctg
accggctacgacggctggctgtcctcggccgggaccatcgggccccggatgcggatcgac
cacgacttctcgctgctggtgcccgaagtgttcagccggatgacgcccaaggaacgggac
gcggccacgctgatcgagcagggctacctggagcggttgaccgacttcgagcacgacggc
gagcaggtcctggccagccgcctgggctaccgcatgaacgaggccttcgccacacagttc
ttcggccggatcttcctgcacccggacgtggtcttcacctccgagatgctcaagcccgag
acccaggacctggacacgttcgccacgtcgatggccaccatcgtcaagacccaccagcgc
gtcgcgcaggcctacttcgacgacggcaccatctccgaggcgatcccgccgctgcgcggc
ctgctggagatcatggccaccggcaccaccgccgacggcctcaccctcgacgacgccgcg
ttccgcgaccagttcacgcgcgacgcggtgctggccgccgactggtacgccgcccgcctg
gacgccaagcgcgacgaggacctcgcccaccaggagcgcagcgcgcacgacctgcggcac
ttcctggggcaggaggccaacgccgaggccgccgagcggctgggcctggccgagcggctc
gccgagatcgaggaggccatcgaggcgatgtcgggccaggagtaccgcgactcgctcgtc
ggcacgatcggacgccagccgctgagccgctga

DBGET integrated database retrieval system