KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0309Help
Entry
PsycPRwf_0309     CDS       T00541                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
prw  Psychrobacter sp. PRwf-1
Brite
Enzymes [BR:prw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PsycPRwf_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABQ93264
UniProt: A5WC73
LinkDB All DBs
Position
369362..369991
Genome map
AA seq 209 aa AA seqDB search
MSNITLPDLPYAKDALEPHISAETLEFHHDKHHAAYVNKLNELLPGSGLEGKALDEIITA
TAKDDSKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKN
AATSQFGSGWAWLVADSVGGKLSIMKTANADTPLAHGKVAVLTCDVWEHAYYIDYRNRRP
DYVDTFLEKLVNWDYANAKYKGQDAGVEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacattactctaccagatcttccttatgcaaaagacgcacttgagccacacatc
agtgctgaaactttagaatttcaccatgacaagcaccatgctgcttatgtcaacaagcta
aatgaattgctaccaggttctggtcttgaaggcaaagcgcttgacgaaatcatcactgcc
actgctaaagatgacagcaagcaaggcatgttcaaccaagctgctcaagtttggaaccat
actttttactggaactgcatgactccagataatggtggcggcgaacctactggtgatcta
aaagcaaaaatcgaagaagatttcggttcatacgacaagttccgtgaagagttcaaaaac
gcagccacttcacagttcggttcaggttgggcgtggttggtagcagattctgtaggcggc
aaactgtctatcatgaaaactgccaacgctgatacaccactagcacacggtaaagtagcg
gttctaacttgtgacgtatgggaacatgcttactacatcgattaccgtaaccgtcgtcct
gactatgttgacactttcctagagaagttggttaactgggattacgcaaacgctaagtac
aaaggtcaagacgcaggcgttgaagaataa

DBGET integrated database retrieval system