KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0800Help
Entry
PsycPRwf_0800     CDS       T00541                                 

Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00550  Peptidoglycan biosynthesis
prw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:prw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PsycPRwf_0800
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PsycPRwf_0800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prw01011]
    PsycPRwf_0800
Enzymes [BR:prw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PsycPRwf_0800
Peptidoglycan biosynthesis and degradation proteins [BR:prw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   PsycPRwf_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABQ93752
UniProt: A5WDL1
LinkDB All DBs
Position
complement(950754..952790)
Genome map
AA seq 678 aa AA seqDB search
MKQPISSDIRQENRVFISRIFFAALFIFLGLSVLMARYWYLQVYSHEKYITQADNNRVKL
ISDPPSRGYIYDRNGYLLADNKPVFTAMLSPDEIEDPARTLHLLAPIFDLTEEDITDILA
RIDKNKNDPVTVKIDITDAQMAQFSERKPFFKGVSIQSKLTRSYPYDDLFAHVIGYVGRI
NDKESKKIDKERYAGTDLIGKIGIENYYEDLLLGKPGHQAVETNVHGDVLRKLDSTPPVP
GNDIYLSLDYGLQKVAQEQLNGRRGAIVAIDPKNGDVLAFVSNPSFDPNPFISGISFKDY
GALRDDPDQPLYNRALQGMYPPASTIKPFEGLGAIHYGVMGWNDTIYDPGYFTLPGDSHR
FRDWKKGGHGTVNLTKSIVMSVDTYYYKLSYQLGIQRLHDWMIRFGFGSPTGIDLPGEKS
GVMPSPKWKKDTYDKDWLPGETISVSIGQGYFLATPLQVANATAMTANLGKKLTPHMLKR
SEGAAEVHPIDRPTGQIEFNGTQADWLKMRDAMEETVKRGTGHGIYTPRYRIAGKTGTAQ
VKSIAQGKSYNKAALDKRHWDHAWFTGFAPVEDPEIAVAVLVENGGGGGSTAAPIGRALF
DYWILRRKSDPIVPPTPDELAIIKAQKAEEKARLDAERDAQAALEEALKEQQKQSGTTQP
GDKPVEKSADKPKPAQSN
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacctatctcttcagatattcgacaagaaaatcgggtgtttatcagccgtatt
ttttttgctgcgctatttatcttcttaggcctttcggtgcttatggcccgctattggtac
ttgcaagtgtattctcacgaaaaatacatcactcaagcagacaacaaccgggttaagctc
atctcagatccgccctctcgcggttatatctatgaccgtaatggctatttgctggccgat
aataagccggtgtttacagccatgcttagcccagatgagattgaggatccggcacgtacg
ttgcatctgttagcgcctatcttcgatttaactgaagaggacattaccgatatcttggca
cgcattgacaaaaataaaaatgatccggtcacggtaaaaattgacatcactgatgcgcaa
atggcgcagtttagtgagcgtaagccattttttaaaggcgtgagcatccaaagcaaacta
acgcgcagctatccttatgatgatttatttgcgcacgttatcggctatgtgggtcgtatt
aatgataaagagtctaagaaaatagacaaagagcgttatgcaggcactgatttaattggc
aagattggtatcgagaattactatgaggatttattgctcggtaagcctgggcatcaagcg
gtcgagaccaacgtccatggcgatgtgctgcgcaaacttgatagcacgccgcctgttcca
ggtaatgacatttatttaagcctagattacggcctacaaaaggtggctcaagaacaactt
aatggccgccgcggtgctattgtcgccattgaccctaaaaatggcgatgtcttagccttc
gttagtaacccaagctttgaccctaacccttttatttcgggcatctcttttaaagattat
ggggcgctgcgcgatgatcccgatcagcctctttataaccgagcgcttcagggcatgtac
cctccggcctctaccatcaagccttttgagggtttgggcgctattcattatggggtaatg
ggctggaatgataccatttatgaccccggctactttaccctaccgggcgacagtcaccgc
tttcgtgactggaaaaaaggcggtcatggtacggttaacctcaccaaatctatcgtcatg
tctgtggatacttactattataaattgtcgtatcaattgggcattcaaagactgcatgat
tggatgatccgctttggctttggcagccctaccggtattgatttgccaggtgagaaatct
ggcgttatgccctcccctaagtggaaaaaagacacctatgataaagactggctaccgggt
gagaccatttcggtcagtattggccaaggctactttttggcgacgccgcttcaggttgct
aatgccacagccatgaccgcaaacttaggtaagaagcttaccccgcacatgcttaagcga
tctgaaggtgctgcagaggtacatcctattgatcggccgacaggtcaaattgaatttaat
ggcacccaagcggactggctaaaaatgcgcgatgcgatggaggagaccgttaaaagagga
accggtcacggtatttatactccgcggtatcgcatcgctggtaaaaccggtaccgctcag
gtcaagtccattgctcagggcaaaagctataacaaggccgctttagataagcgccactgg
gaccacgcgtggttcaccggctttgcaccggtagaagaccctgagattgctgtggccgtc
ttggtcgaaaacggtggcggtggtggctcaacagccgcaccgattggccgcgccttgttt
gattattggatactgcgccgtaaaagcgacccaatcgtaccacctacacccgacgagctg
gccattataaaagcgcaaaaggctgaagaaaaagcacgcctagatgccgaacgtgatgcc
caagctgcgctagaagaagccctaaaagagcagcaaaagcagagcggcactactcagcct
ggagacaagcctgttgaaaaatctgccgacaagccaaaaccggcccaaagcaattaa

DBGET integrated database retrieval system