KEGG   Pseudomonas stutzeri A1501: PST_0005Help
Entry
PST_0005          CDS       T00511                                 

Gene name
ahpF-1
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psa  Pseudomonas stutzeri A1501
Brite
KEGG Orthology (KO) [BR:psa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PST_0005 (ahpF-1)
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PST_0005 (ahpF-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 K_oxygenase Glutaredoxin NAD_binding_8 Thi4 FMO-like
Motif
Other DBs
NCBI-ProteinID: ABP77713
UniProt: A4VFG2
LinkDB All DBs
Position
6798..8360
Genome map
AA seq 520 aa AA seqDB search
MLDSNLKTQLKAYLEKVTQPFEIVASLDDGEKSRELLSLLQDIAGLSDKITLKTDGDDAR
KPSFSLNRIGGNISLRFAGIPMGHEFTSLVLALLQVGGHPSKTAPEVIEQIKALDGDYRF
ETYFSLSCQNCPDVVQALNLMAVLNPNVKHVAIDGALFQDEVEARQIMSVPSIYLNGELF
TQGRMSEEEILAKLDTGSSARDAEKLKAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLARALEEHVREYEVDIMNLQRASQLIPAGEDGL
HRVRFDNGGELKAKTLILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGEDLRADAVLQRKLNSLPNVRVLKMAQTTEVKGDGQ
KVTGLIYKDRSSEEMHSVELEGIFVQIGLLPNSEWLKGTLELSRFGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggattccaatctcaagacccagttgaaagcctacctggagaaggtcacccagccc
ttcgagatcgtcgcgtccctcgatgacggcgagaaatcccgggagctgctgagcctgctg
caggacatcgccggcctcagcgacaagatcaccttgaagaccgacggcgacgatgcgcgc
aagccgtcgttctcgctcaaccgcatcggcggcaacatcagcctgcgtttcgccggcatc
cccatgggccacgaattcacctcgctggtgctggccctgctgcaggtcggcgggcacccg
tcgaagaccgcaccggaagtcattgagcagatcaaggccctcgacggcgactaccgcttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacgtcaagcacgtggccatcgacggcgcgctgttccaggat
gaagtcgaagcgcggcagatcatgtcggtgccgagcatctacctcaacggcgagctgttc
acccagggccgcatgagcgaggaagaaatcctcgccaagctcgacaccggttccagcgcc
cgtgatgccgagaagctcaaggccaaggacgccttcgacgtgctggtggtgggcggcggc
ccggccggcgccgcagcggccatctacgccgcgcgcaagggcatccgcaccggcgtcgcg
gccgagcgcttcggcggtcaggtgctcgacaccatggccatcgagaacttcatttcggtg
aaggaaaccgaaggcccgaaactggcccgcgcgctggaggagcacgtgcgcgagtacgag
gtcgacatcatgaacctgcagcgcgccagccagctgatcccggccggcgaagacggcctg
caccgcgtccggttcgacaatggcggcgagctcaaggccaagaccctgatcctcgccact
ggcgcgcgctggcgcgaaatgaacgtgccgggcgagcaggaataccgcggccgtggcgtc
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggc
ggtggcaactccggcgtggaagcggccatcgacctggccggcatcgtcgcccacgtgacc
ctgctggaattcggcgaagacctgcgtgccgacgccgtattgcagcgcaagctcaacagc
ctccccaacgtccgcgtgctgaagatggcgcagaccaccgaggtcaagggcgacggccag
aaggtcacgggcctgatctacaaggaccgcagcagcgaagaaatgcacagcgtcgagctg
gaaggcatcttcgtgcagatcggcttgctgcccaacagcgaatggctcaagggcaccctg
gagctgtcgcgtttcggcgagatcatcgtcgacgccaagggccagaccagcatccccggt
gtgttcgccgccggtgacgtgaccacggtgccgtacaagcagatcgtgatcgccgtcggc
gaaggcgccaaggcctcgctgagcgccttcgatcacctgatccgcacctccgcgccggcc
tga

DBGET integrated database retrieval system