KEGG   Pseudomonas stutzeri A1501: PST_0558Help
Entry
PST_0558          CDS       T00511                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01130  Biosynthesis of antibiotics
psa01230  Biosynthesis of amino acids
Module
psa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:psa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PST_0558 (aroK)
Enzymes [BR:psa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PST_0558 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABP78264
UniProt: A4VH13
LinkDB All DBs
Position
622416..622883
Genome map
AA seq 155 aa AA seqDB search
MPFKDSDKEIEQRTGASIPLIFDVEGEAGFRERERAVIADLCQQDGVVLATGGGAVLRED
NRKALRSGGRVVYLCTSVDQQLERTSRDRNRPLLQASDPRSVLAALMAIRDPLYRSIADI
IIETDERPPRLVVMEILDRLASLPPRESQDESALS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
ttgccgttcaaggattccgacaaggaaatcgagcagcggaccggcgccagcattcctctg
atcttcgatgtagagggtgaggccggttttcgcgagcgtgaacgtgcagtgattgccgat
ctttgtcagcaggacggggtggtgctcgctacgggtgggggcgcggtgttgcgcgaggac
aatcgcaaggcacttcgctccggtggtcgcgtcgtctatctctgcacttctgtcgatcag
cagctcgagcgcacgtcgcgcgaccgcaatcgtccgttgcttcaggcaagcgatccccgt
agcgttcttgctgcgctcatggctattcgcgacccgctgtaccgctccattgcggatatc
atcatcgagacagacgagcgtccgccgcggctggtggtcatggaaattctcgataggctc
gcttcattgcctccccgtgaaagccaggatgaatctgcgctatcctag

DBGET integrated database retrieval system