KEGG   Pseudomonas stutzeri A1501: PST_0782Help
Entry
PST_0782          CDS       T00511                                 

Gene name
tuf-1
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
psa  Pseudomonas stutzeri A1501
Brite
KEGG Orthology (KO) [BR:psa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:psa03012]
    PST_0782 (tuf-1)
   03029 Mitochondrial biogenesis [BR:psa03029]
    PST_0782 (tuf-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psa04147]
    PST_0782 (tuf-1)
Translation factors [BR:psa03012]
 Eukaryotic Type
  Elongation factors
   PST_0782 (tuf-1)
 Prokaryotic Type
   PST_0782 (tuf-1)
Mitochondrial biogenesis [BR:psa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PST_0782 (tuf-1)
Exosome [BR:psa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PST_0782 (tuf-1)
  Exosomal proteins of breast cancer cells
   PST_0782 (tuf-1)
  Exosomal proteins of colorectal cancer cells
   PST_0782 (tuf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABP78479
UniProt: A4VHM8
LinkDB All DBs
Position
891381..892574
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSARVDFDKIDSAPEEKARG
ITINTAHVEYDSNVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GEDDNELGTTAVKKLVETLDSYIPEPVRAIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
KVQEEIEIVGLRPTTKTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDEVERGQVLAKPG
TIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSCELPEGVEMVMPGDNV
KMVVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIVE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaggaaaaattcgaacgtaacaaaccgcacgtcaacgtcggcaccattggtcac
gtcgaccatggcaagaccactctgactgccgctctgactcgcgtgtgctccgaggtcttc
ggttccgctcgtgtcgacttcgacaagatcgatagcgctccggaagagaaggctcgcggt
atcaccatcaacaccgcccacgtagagtacgactccaacgtccgtcactacgcgcacgtt
gactgcccgggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgctgacggccccatgccgcagactcgcgagcacatc
ctgctgtcccgtcaggttggtgttccgtacatcgtcgtgttcctgaacaaggccgacatg
gttgatgacgccgagctgctcgagctggtcgagatggaagttcgcgacctgctgtcgacc
tacgacttcccgggtgacgacactccgatcatcatcggctccgcgctgatggcgctgaac
ggcgaagacgacaacgagctcggcaccaccgcggtgaagaagctggtcgaaaccctggac
agctacatccccgagccggttcgtgccatcgacaagccgttcctgatgccgatcgaagac
gtgttctcgatctccggtcgcggcaccgtggtaaccggtcgcgtagagcgcggcatcgtc
aaggttcaggaagagatcgagatcgtcggtctgcgtccgaccaccaagactacctgcacc
ggcgttgagatgttccgcaagctgctcgacgaaggtcgcgctggcgagaactgcggcgtg
ctgctgcgtggcaccaagcgtgacgaagtggagcgtggtcaggttctggccaagccgggc
accatcaagccgcacaccaagttcgaagccgaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgtccgcagttctacttccgtaccactgac
gtgaccggttcgtgcgaactgccggaaggcgtcgagatggtaatgccgggcgacaacgtg
aagatggttgtcaccctgatcaagccgatcgccatggaagacggcctgcgcttcgcgatt
cgcgaaggtggtcgtaccgttggtgccggcgtggttgccaagatcgtcgagtaa

DBGET integrated database retrieval system