KEGG   Pseudomonas stutzeri A1501: PST_1084Help
Entry
PST_1084          CDS       T00511                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00473  D-Alanine metabolism
psa00550  Peptidoglycan biosynthesis
psa01100  Metabolic pathways
psa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PST_1084 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PST_1084 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PST_1084 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psa01011]
    PST_1084 (ddlB)
Enzymes [BR:psa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PST_1084 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:psa01011]
 Precursor biosynthesis
  Amino acid ligase
   PST_1084 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK TTL ATPgrasp_YheCD ATPgrasp_Ter ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABP78781
UniProt: A4VII0
LinkDB All DBs
Position
1193898..1194842
Genome map
AA seq 314 aa AA seqDB search
MMALQSTRDPKEFGRVAVLFGGKSAEREVSLKSGAAVLAALQAAGVDAFGIDAGDDLLQR
LSSERIDRAFIVLHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWQSLGL
PTPRHAVLASEVDCQAAAQMLGFPLIVKPAHEGSSIGMAKVGDVAELIAAWRAASAYDAQ
VLVEQWIQGPEFTVAVLHGEVLPPIGLGTPHTFYDYDAKYLASDTQYRIPCGLDAAREEA
LKVLSARACEAVGIRGWARVDVMQDAEGNFWLLEVNTVPGMTDHSLVPMAARAAGLDFQQ
LVLSILDDSLEAGN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatggctttgcaatcgacgcgcgaccccaaggaattcggccgcgtcgccgtgctcttc
ggcggcaagagcgccgagcgcgaggtctccctcaagtccggcgctgccgtgctcgccgcg
ttgcaggcggcgggtgtggatgccttcggtatcgatgccggtgatgacctgctgcagcgc
ctgagcagcgagcggatcgaccgtgcctttatcgtcctgcacggccgcggtggcgaagac
ggcagcatgcaggggctgctggagtgtgccggcattccttacaccggcagcggcatcctc
gcctcggcgctggccatggacaagctgcgcaccaagcaggtctggcagagcctcggcctg
ccaacgccgcggcacgcggtgctggccagcgaagtcgactgccaggccgcggcccagatg
ctgggctttccgctgatcgtcaagccggcgcacgagggatcgagcatcggtatggccaag
gttggcgatgtcgccgagctgatcgccgcctggcgcgcagcgagcgcctatgacgcgcag
gtgctggttgaacagtggatccagggccccgagttcaccgtggcggtgctgcacggtgag
gtcctgccgccgattggcctgggcacgccgcataccttttacgactacgacgccaagtac
ctggcctccgatacccagtaccgcatcccctgcgggctggacgcggcccgcgaagaagca
ctcaaggtgctctcggcgcgtgcctgcgaggcggtgggtattcgcggttgggcgcgggtg
gacgtgatgcaggatgccgagggcaacttctggctgctggaagtgaacaccgtgcccggc
atgaccgatcacagcctggtgccgatggcggcgcgtgccgccgggctggatttccagcag
ctggtgctgagcattctcgacgacagcctcgaggcggggaactga

DBGET integrated database retrieval system