KEGG   Pseudomonas stutzeri A1501: PST_2409Help
Entry
PST_2409          CDS       T00511                                 

Definition
(GenBank) assimilatory nitrite reductase large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00910  Nitrogen metabolism
psa01100  Metabolic pathways
psa01120  Microbial metabolism in diverse environments
Module
psa_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:psa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PST_2409
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     PST_2409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Rubredoxin_C NIR_SIR_ferr Pyr_redox_3 NAD_binding_7 PET117 AlaDh_PNT_C GIDA Trp_halogenase FAD_binding_3 3HCDH_N NAD_binding_8 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABP80061
UniProt: A4VM60
LinkDB All DBs
Position
2631627..2634092
Genome map
AA seq 821 aa AA seqDB search
MKKLKLVMIGNGMAGVRTLEELLKLTDELYDITVFGAEPHPNYNRILLSPVLAGEQQFEE
IVLNDLDWYAENGIRLMLKRKVVKIDRARRRVIADDGSEAEYDRLLIATGSNPFILPIPG
NDLQGVIGYRDIADTQVMMETAKTHKHAVVIGGGLLGLEAANGLKLRGMDVTVVHIGDWL
MERQLDKTAGTLLQSALESRGLKFLLPKQTAELIGNGEGRVKAVRFADGEVIPADLVVMA
AGIRPNSELAEQAGLPCNRGILVNDTLQTYDPRIYAVGECANHRGTAYGLVAPLFEQAKV
CANHLAMLGFSRYLGSVTSTKLKVTGIDLFSAGDFIGGEGTETITLSDPIGGVYKKLVIK
DDVLVGACLYGDTADGGWYFRQVREGQNVAQIRDHLMFGAAGLGEGAIGDAGHQGQSKTM
SMPDDMEVCGCNGVCKGTIVKAVQEHGLFSVDEVKKHTKAASSCGSCTGLVEQILINTVG
GAADVKPKSEKAICGCSDLNHGQVRKAIREHHLISIPAAMAFMEWRTPNGCATCRPALNY
YLISTWPGEAKDDPQSRFINERAHANIQKDGTYSVVPRMWGGVTNAAELRRIADVADKYQ
VPMVKVTGGQRIDLLGIRKEDLPGVWKDLDMPSGHAYGKSIRTVKTCVGSEFCRFGTQNS
TQMGIDLEHALFNMWSPHKVKLAVSGCPRNCAESGIKDVGIIGVDSGWELYIGGNGGIKT
EAGEFFVKVKSAEEVMEYSLAFLQLYREEAFYLERTVHYLQRVGMDHIKQAVLNDAERRK
ALHQRLLFSLSFEQDPWQEQLSKPQLKKEFDRIAVKQLENA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactcaaactggtgatgatcggcaacggcatggccggcgtgcgaaccctcgaa
gagctgctcaagctgaccgacgagctctacgacatcacggtgttcggcgccgagccgcat
cccaactacaaccgcatcctgctctcccccgtgctggccggcgagcagcagttcgaagag
atcgtgctcaacgacctggactggtacgccgagaacggcattcgcctgatgctcaagcgc
aaggtggtgaagatcgatcgcgcccgtcgccgggtcatcgccgacgacggcagcgaggcc
gaatatgaccgcctccttatcgccaccggctccaatccgttcatcctgcccattcccggt
aacgaccttcagggagtgattggttaccgcgacatcgccgatacccaggtgatgatggaa
accgccaagacccacaagcacgcggtggtcattggcggcggcctgctcggcctagaggcg
gccaatggcctcaagctgcgcgggatggatgtgaccgtggtgcacatcggtgactggctg
atggagcgccagctggacaagaccgctggcaccctgctgcagagcgccctggagagccgc
ggcctgaagttcctgctgccaaagcagacagccgagctgatcggcaacggcgaaggccgc
gtcaaggccgtacgcttcgctgatggcgaggtgattcccgctgacctggtggtgatggcc
gccggcatccgccccaacagcgagctggccgagcaagcaggcctgccttgcaaccgcggc
atcctggtcaacgacaccctgcagacctacgatccgcgcatctacgccgtcggcgaatgt
gccaatcatcgcggcaccgcctatggcctggtcgctccgctgttcgaacaggccaaggtc
tgcgccaaccacctcgccatgctcggcttttcccgctatctcggctcggtgacttcgacc
aagctcaaggttaccggcatcgacctgttctcggccggcgatttcatcggcggcgaaggc
acagagaccatcaccctctccgaccccatcggcggcgtatacaagaaactggtgatcaag
gatgacgtgctggtcggtgcctgcctctacggcgacaccgccgacggcggctggtacttc
cgccaggtgcgcgagggccagaacgtcgcgcagatccgcgaccatctgatgtttggcgcg
gccggcttaggcgagggcgccatcggcgatgccggccatcagggccagagcaagaccatg
tccatgccggacgacatggaagtctgcggctgcaacggggtgtgcaagggcaccatcgtc
aaggcggtccaggagcacgggctgttctcggtggacgaggtgaaaaagcacaccaaggcc
gccagttcctgtggttcctgcaccgggctggtcgaacagattctgatcaacaccgtgggc
ggcgcggccgacgtcaagccgaagagcgagaaggccatctgcggctgcagcgacctcaac
catggccaggtgcgcaaggccattcgcgagcaccacctgatcagcatcccggcggccatg
gccttcatggaatggcgcacgccgaacggctgcgccacctgccgcccggcgctgaactac
tacctgatctccacctggccgggcgaggccaaggacgatccgcagtcacgtttcatcaac
gagcgagcccacgccaacatccagaaggacggcacctactccgtggtgccgcggatgtgg
ggtggcgtcaccaatgccgccgagctgcgacgcatcgccgacgtggcggacaagtaccaa
gtgccgatggtcaaggtcactggcggccagcgcatcgacctgctgggtatccgcaaggaa
gacctgccgggcgtctggaaagacctggacatgccttccggccacgcctacggcaaatcc
atccgcaccgtgaagacctgcgtcggcagcgagttctgccgcttcggcacgcagaactcg
acgcagatgggcatcgacctggaacacgcgctgttcaacatgtggtcgccgcacaaggtc
aagctggccgtctccggctgcccgcgcaattgcgccgaatccggcatcaaggacgtgggt
atcatcggtgtggactccggctgggagctgtacatcggcggcaacggcggcatcaagacc
gaggccggcgagttcttcgtcaaggtgaagagcgccgaggaggtcatggaatacagcctg
gcgttcctccagctctaccgcgaggaagccttctacctcgaacgcaccgtgcactacctg
cagcgcgtcggcatggatcacatcaaacaggccgtgctgaacgatgccgagcggcgcaag
gcgctgcaccagcggctgctgttctcgctttccttcgagcaggacccgtggcaggagcag
ctttccaagccgcagctgaagaaggaattcgaccgcatcgccgtcaagcagctggaaaac
gcctga

DBGET integrated database retrieval system