KEGG   Pseudomonas stutzeri A1501: PST_2471Help
Entry
PST_2471          CDS       T00511                                 

Gene name
gstA
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PST_2471 (gstA)
Enzymes [BR:psa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PST_2471 (gstA)
Transporters [BR:psa02000]
 Other Transporters
  Pores ion channels [TC:1]
   PST_2471 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABP80123
UniProt: A4VMC2
LinkDB All DBs
Position
2697038..2697709
Genome map
AA seq 223 aa AA seqDB search
MITVHHLNHSRSHRVLWMLEELELLYELKRYERDPRTMLAPPELKAVHPLGKSPVITDGD
LTLAESAAILEYLLERYANGRLMPAQGSADYRRFRYWMHYAEGSAMPPLLLKLVFDRVAS
GPMPFFIKPVARAIANGAHKAFIGPQLKTHLDYMEAELEKSPWFAGDSFSAADIQMSFPL
EAARSRAGLDQSRPRLLAFLERIQQRPAYQRAVERGGPALPTA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtccaccacttgaaccattcccgctcgcaccgcgtgctctggatgctggag
gaactggagctgctgtacgagttgaagcgctacgagcgcgatccgagaaccatgctcgct
ccgccggaactgaaagccgttcacccgttgggcaaatccccggttatcactgacggtgac
ctgaccctggcagagtcggctgcgattctcgaatacctgctggagcgctacgccaacggt
cggctgatgccggcccagggaagcgccgactaccgacggtttcgctactggatgcattac
gcggaagggtcggccatgccgccgcttctgctgaagctggtgtttgaccgggtcgccagc
gggccgatgccgtttttcatcaagcccgtagcccgtgccatcgccaacggcgcgcacaag
gcgttcatcggtcctcaactgaagacgcatctggactatatggaagcggagctggagaaa
tccccctggttcgcaggagacagcttcagcgcggcggatattcagatgagctttccgctc
gaagcggcacgctcgagagcggggctggaccagagccgcccgcgcctgttggcctttctc
gaacgcatacagcaacggcccgcctatcaacgagccgtcgaacgcggcggaccggccctg
cccaccgcgtga

DBGET integrated database retrieval system