KEGG   Pseudomonas stutzeri A1501: PST_2745Help
Entry
PST_2745          CDS       T00511                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00620  Pyruvate metabolism
psa00680  Methane metabolism
psa01100  Metabolic pathways
psa01120  Microbial metabolism in diverse environments
psa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PST_2745 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    PST_2745 (ppc)
Enzymes [BR:psa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PST_2745 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABP80395
UniProt: A4VN44
LinkDB All DBs
Position
complement(2970024..2972663)
Genome map
AA seq 879 aa AA seqDB search
MAKIIDARLRDNVHLLGELLGNTIRAQHGDQFFDKIERIRKGAKAARKGSAEGAQLLAET
LDSLDESELLPMTRAFNQFLNLANIAEQYHQVRRRAAGEPAPFEIGVFADLIERLKAAGH
DNEFIARQVSRLEIELVLTAHPTEVSRRTLIQKYDAIAQQLAARDHTDLSDAERASIELS
LQRLIAEVWHTEEIRRNRPTPVEEAKWGFAAIENSLWKAVPNVLRQTDATLHRLTGLHLP
LEAAPIRFASWMGGDRDGNPNVTAMVSREVLLTARWVAADLYLREIEGLITALSMREASD
ELLRQSGDSAEPYRVLLKPLRQRLRATREWARAAIEHGQPAPAEVLQDCAELRRPLELCY
RSLHACGMGVIADGALLDCLRRLAVFGLFLVRLDIRQDAARHAAALAEITDYLGLGDYQQ
WDEQKRLDWLQHELANRRPLLPAHYHPSADTAEVLATCAVIAEAPAASLGSYVISMAHAA
SDVLAVQLLLKEAGLQRPMRVVPLFETLDDLNNAAPTIDRLLSLPGYRQRLHGPQEVMIG
YSDSAKDAGTTAAAWAQYRAQEQLVEVCREHGVELLLFHGRGGTVGRGGGPAHAAILSQP
PGSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPEPGWRETMDRL
AAEGVAAYRGVVREHPLFVDYFRQATPELELGRLPLGSRPAKRREGGVESLRAIPWIFAW
TQTRLMLPAWLGWEQALHGALQRGEGERLAEMRARWPFFSTRIDMLEMVLAKADADIARR
YDERLVQPELLSLGSDLRDRLSQVIEAVLSLTGQSDLLDHSPKTQEAFSLRNTYLDPLHL
MQIELLARSRQRQGPAESPLEQALLVSVAGIAAGLRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatcatcgatgcgcgcctgcgcgacaacgtacacctgctcggcgaactgctg
ggcaataccatccgcgcgcagcatggcgatcagttcttcgacaagatcgagcgcatccgc
aagggcgccaaggctgcgcgcaagggctcggcagagggcgcacagctgctggccgaaacg
ctcgacagtctcgacgagagcgaactgctgcccatgacccgggcgttcaaccagtttctc
aatctggccaatatcgccgagcagtatcatcaggtgcgccggcgcgccgcaggcgagccg
gcgccgttcgagatcggggtgttcgccgatcttatcgagcgtctcaaggcggccgggcac
gacaacgagttcatcgcgcggcaggtcagccgcctggaaatcgaactggtgctcaccgcg
catcccaccgaggtatcgcgccgcacgctgatccagaagtacgacgccatcgcccagcag
ctggcggcacgggatcacaccgatctctccgacgccgagcgggcgagcatcgagttgagc
ctgcagcgcctgatcgccgaggtgtggcacaccgaggagatacgccgcaaccggccgacc
ccggtggaggaggccaaatggggtttcgctgccatcgagaattcgctgtggaaggcggtg
cccaacgtgctgcgccagaccgacgcgaccctgcaccgcctcaccggcctgcacctgcca
ttggaggccgcgccgatccgcttcgcctcctggatggggggcgaccgcgacggcaacccg
aacgtcaccgcgatggtgtcgcgcgaggtgctgctgaccgcccgttgggtggccgccgat
ctctacctacgcgagatagaagggctgattaccgcgctgtccatgcgcgaggccagtgac
gaactgctgcgccagagcggcgactcggccgagccctatcgcgtcttgctcaagccgctg
cgccagcgcctgcgggcgacacgtgagtgggcccgcgcggccatcgagcacggccagcca
gcgccggcggaagtcctgcaggattgcgccgagctgcgtcgtccgctggagctgtgctac
cgctccctgcacgcttgcggcatgggggttatcgccgacggcgctctgctcgactgcctg
cgtcgcctggccgtgttcggcctgttcctggtgcggctggacattcgccaggatgcggcc
cgtcatgccgccgcgctggccgagatcaccgattacctcgggctaggcgactatcagcag
tgggatgagcagaagcgcctggactggctacagcacgagctggccaatcggcgcccgctg
ctgccggcgcattaccacccatccgccgataccgccgaagtgctcgccacctgtgcggtg
atcgccgaagcgccagcggcgtcgctgggttcctacgtcatctccatggctcacgcggcc
tccgatgtgctcgccgtacaactgttgctcaaggaggccggcctgcagcgaccgatgcgc
gtggtgccgctgttcgagaccctcgatgacctgaacaacgcggcaccgaccatcgatcgt
ctgctttccctgccgggctatcgccagcgcctgcatggcccccaggaagtgatgattggc
tactccgattcagcgaaggacgccggtaccacggcggcggcctgggcccagtaccgggcc
caggaacaactggtggaggtctgtcgcgagcacggcgtcgaactgctgctgttccacggc
cgcggcggcaccgtcgggcgcggcggcggtccggcccatgcagcgatcctgtcgcagccg
ccgggctcggtcgccgggcgcttccgcaccaccgagcagggcgaaatgatccgcttcaag
ttcggcctgccggatatcgccgagcagaacctcaacctgtacctcgcggcggtgctcgaa
gcgacgctgctgccgccaccgccccctgaacctggctggcgcgagacgatggaccggctt
gccgccgagggtgttgcggcctaccgcggcgtggtgcgcgagcatccactgttcgttgac
tacttccggcaggcgacacctgaactggagttggggcgcctgccgctgggcagccggccg
gccaagcgccgcgaaggcggcgtcgagagcctgcgggcgattccctggatcttcgcctgg
acccagactcgcctgatgttgccggcctggctgggctgggagcaggcgctgcacggggcg
ctgcagcgcggggagggcgagcggctggccgagatgcgtgcgcgctggccattcttcagt
acgcgcatcgacatgctggagatggtgctggccaaggctgacgccgacatcgcgcggcgc
tacgacgagcgtctggtgcagcctgagctgctttcgctgggtagcgatttgcgtgaccga
ttgtcgcaggtcatcgaggcggtgctgagcctgaccggccagtcggatctgctcgatcac
agccccaagacccaggaggcattcagtttgcgcaatacctacctggacccgctgcacctg
atgcagatcgagttgctggcgcgttccaggcagcggcaaggcccggcggagagccccctc
gagcaggccctgctggtcagcgtggcgggcatcgcggccggtctgcgcaataccggctga

DBGET integrated database retrieval system