KEGG   Pseudomonas stutzeri A1501: PST_3803Help
Entry
PST_3803          CDS       T00511                                 

Definition
(GenBank) alcohol dehydrogenase (Zn-dependent)
Organism
psa  Pseudomonas stutzeri A1501
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ABP81426
UniProt: A4VR25
LinkDB All DBs
Position
4112023..4113096
Genome map
AA seq 357 aa AA seqDB search
MAMMKAAVFVEPGRIELQDKPIPEIGPNDALLRITTTTICGTDVHILKGEYPVAPGLTIG
HEPVGIIEKLGCNVKGYQEGQRVIAGAICPSFTSYACQDGLPAQDGGCSCHGYKPMGGWR
FGNTIDGTQAEYVLVPDAQANLAPVPDALTDEQVLMCPDIMSTGFAGAEAANIKIGDIVV
IFAQGPIGLCATAGARLRGAGTIIAVDGVDARLDIARKMGADVTLNFRNVDVVEEVLKLT
GGRGVDASIEALGLQSTFESALRVLKPGGTLSSLGVYSSDLSIPLGAFHAGLGDNKIVTS
LCPGGKERMRRLLNVVASGRVDLAPLVTHHYALDDIGAAYDLFANQRDGVLKVAIKP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccatgatgaaagccgccgtgttcgtcgagccgggccgcatcgaactgcaggacaag
cccatccccgagattggtcccaacgatgcgctgctgcgcatcaccacgaccaccatctgc
ggcaccgacgtccacattctcaagggtgaatacccggtcgctcccggcctgaccatcggt
cacgaaccggtgggcatcatcgaaaagctgggctgcaacgtgaagggctaccaggaaggc
cagcgggtgatcgccggcgccatctgccccagcttcacctcctacgcctgccaggacggc
ctgcccgctcaggatggcggctgctcctgccatggctacaagcccatgggcggctggcga
ttcggcaataccatcgacggcactcaggccgaatacgtgctggtgcccgacgcccaagcc
aacctggcgccggtgccggacgcgctgaccgacgagcaggtgctgatgtgtccggacatc
atgtccaccggtttcgctggcgccgaggcggccaatatcaagatcggcgatatcgtggtg
atcttcgcccagggcccgatcgggctgtgcgccaccgccggcgcccggctgcgcggcgcc
ggcaccatcatcgcggtggacggcgtggatgcgcggctggatatcgcgcgcaagatgggt
gcggatgtgacgctcaacttccgcaatgtggatgtggtggaggaagtgctgaaactgacc
ggtggccgcggcgtcgacgcctcgatcgaggcgctgggcctgcaatcgaccttcgaaagt
gcgctgcgggtgctcaagccgggcggaaccctgtccagtctgggcgtctactccagcgac
ctgagcattccgctgggcgccttccatgccggcctgggcgacaacaagatcgtcacctcg
ctctgccccggcggcaaggaacgcatgcgccgactgctcaatgtggtggcgtccggccgc
gtcgatctcgccccgctggtcacccatcactacgcgctggacgacatcggtgccgcctat
gacctgttcgccaatcagcgcgacggtgtgctgaaggtggcgatcaagccctga

DBGET integrated database retrieval system