KEGG   Paenibacillus sabinae: PSAB_05620Help
Entry
PSAB_05620        CDS       T03064                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
psab  Paenibacillus sabinae
Pathway
psab00473  D-Alanine metabolism
psab01100  Metabolic pathways
psab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSAB_05620
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PSAB_05620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psab01011]
    PSAB_05620
Enzymes [BR:psab01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PSAB_05620
Peptidoglycan biosynthesis and degradation proteins [BR:psab01011]
 Precursor biosynthesis
  Racemase
   PSAB_05620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a PAAR_motif TCL1_MTCP1
Motif
Other DBs
NCBI-ProteinID: AHV96060
UniProt: X4ZH44
LinkDB All DBs
Position
1277244..1278446
Genome map
AA seq 400 aa AA seqDB search
MQESYRPTVAEIDLDALRANYESFRQHLSAGMKFMVCVKGNAYGHGAVEVTRELERLSAD
YVSVAFLDEAIELRQAGIGLPILVLGYTPPEAIEAAWENDVTVTLFTPEVLEAASKLPVN
DSRKLKVHIKIDSGMGRLGLLPADARPFIEEAQRVRQLELEGMFTHFAKADEADKSYTLE
QYRRFMSVTEALRERQIHIPIIHTGNSATAIDTPHLSPNMVRVGVSIYGFYPSTEVNRQQ
VKLHPVMTLKTKAVYVKSLPESWGISYGTRYRADSGEYIATLPIGYADGYSRMLSGKAEV
LIRGRRVPVVGTICMDQCMVSLKSFAKEAEQIKAGEEVVLIGSQAGGSITADELALHLGT
IHYEVTCMLAHRVPRVYIREGSAPRLVNALLQSGSPNPVG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagaaagctatcgaccgaccgtagccgagattgatttggatgctttgcgcgcaaat
tacgaaagcttccgccagcatttgtcggcgggtatgaagtttatggtttgcgtcaaagga
aatgcctacggtcatggggcagtggaagtgacgcgggaacttgaacgcctgagtgcggat
tatgtcagtgtggcttttctggacgaggcgatcgagctgcgtcaggcgggaatcggcctg
ccgattctggtgcttggctatacgcccccggaagccattgaggccgcctgggagaacgac
gtaaccgtgacgctttttactcctgaagtgctggaggcggcatcgaagcttcctgtgaat
gacagccggaagctgaaggtgcacatcaagatcgacagcggcatgggccgactcggactt
cttccggccgatgcgcggccgttcattgaagaggcgcagcgcgttcggcagttggaattg
gaggggatgttcacccattttgccaaagcggatgaagcagacaaaagctatacactggag
cagtaccgacggttcatgagcgtgacggaagcgcttcgggaaagacagatccacatcccg
atcatacatacgggcaatagcgctacggccattgataccccgcatttatctccgaacatg
gttcgcgtgggcgtcagcatatacggattctatccgtcgaccgaggtgaaccggcagcag
gtgaagctgcacccggtcatgacgctgaagactaaggctgtatatgtcaaaagcctgccg
gagagctggggcatcagctacggcacccgctaccgcgcagatagcggcgaatatatcgcc
acgctgcccatagggtacgcagacggatattcccgcatgctgagcggcaaggcagaggtg
ttaatacgcggccgccgcgttcctgtcgtcggaaccatctgcatggaccagtgtatggta
tcgctcaaatctttcgccaaagaggcggaacaaatcaaagccggcgaagaggttgtactc
atcggcagtcaggctggcggctccattacggcagacgagctggctctccatcttggaacg
atacactatgaggtgacctgcatgctggcccaccgggtgccgcgcgtttatatccgcgaa
ggctcggctccccgcctggtaaatgccttactgcaatccggaagccccaatcctgtagga
taa

DBGET integrated database retrieval system