KEGG   Paenibacillus sabinae: PSAB_11785Help
Entry
PSAB_11785        CDS       T03064                                 

Definition
(GenBank) nitrite reductase (NAD(P)H) large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
psab  Paenibacillus sabinae
Pathway
psab00910  Nitrogen metabolism
psab01100  Metabolic pathways
psab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psab00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PSAB_11785
Enzymes [BR:psab01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     PSAB_11785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Rubredoxin_C Pyr_redox NIR_SIR_ferr Pyr_redox_3 AlaDh_PNT_C NAD_binding_7 FAD_binding_2 NAD_binding_9 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AHV97285
UniProt: X4ZKR5
LinkDB All DBs
Position
2594491..2596935
Genome map
AA seq 814 aa AA seqDB search
MIKSSRKKLVLVGNGMAGVRAIEHLLKLAPDTYEITIFGAEPHPNYNRIMLSSVLAGGTD
LSEIVINDYEWYKNHNITLYTGHKIESIDTENKVVRSDLGVEAAYDELILATGSDPFMLP
LPGADKEGVIAFRDIKDCQIMMETAKSYKKAVVIGGGLLGLEAARGLLHLGMDVSVVHIS
EYIMERQLDREASVMLQKELEAQGMKFLLTKQSEAILGKKRVKSLLFADGSTAEADLIVM
AVGIRPNTALAKKSGITVNRGIVVNDYMETNIPGVYAIGECAEHRGIAYGLVAPLYEQGA
VLAKKLAGVETQGYEGSVTSTKLKVSGVDVFSGGQYEEPAGSRALRYQDEIGGVYKKLVI
REDKLIGAVLFGDTADGAQLFSLIKSGESIQGKERALLLGLLDDAVKSSPTARLEAMADD
EIICGCNGVSKGAIAEAITSGGCTSVGQIKACTKASASCGGCKPLVEGLLELYAGDAAVK
VKEGICGCTTLSRDEIVAEIKRMELKSVKEVMNVLEWNNEEGCSKCRPSLNYYLGMLWPE
EYVDEKESRITNERFHANIQKDGTYSVVPRIYGGVTSPAELKKIAEVAEKFDVPLVKFTG
GQRLDLLGIKKEDLPKIWEELDMPSGHAYGKTLRTVKTCVGSTFCRFGTQDSIAMGIRLE
KEFERLNTPAKVKLAVSGCPRNCAEATIKDFGVVAIDGGWELHVGGNGGVHVRATDLLCV
VKTEDEVVEWASAFLQYYRENAGWNERTSTWVERVGLDSIKKALEEREERLALQERIQTA
LSVTTDPWKEIVSNKKLRKNFEPISRTETVYQEG
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatcatcacgtaaaaaactggtgcttgtaggcaatggcatggcgggtgtgcgg
gcaatcgagcatctgctcaagctggctcccgatacttatgaaataacgatctttggcgcc
gagccgcatccgaactacaatcggattatgctgtcctccgttttggcagggggaaccgat
ttatccgaaatcgttattaacgattatgaatggtataagaatcataatatcactctgtat
acaggacacaaaatcgagagtatcgatacggagaacaaagttgtccgttccgacctcggg
gtggaggcggcttatgacgagctgattctcgctaccggttctgatccgtttatgctcccg
cttccgggagcggacaaggagggcgttatcgctttccgcgatatcaaagactgtcaaatc
atgatggaaactgcaaagtcctataaaaaagccgttgtaatcggcggaggactgcttggc
ctggaagcggcccgtggcctgctgcatctgggaatggacgtctccgttgtccatatttcc
gaatatataatggaaaggcagctcgacagggaagcatcggtcatgctgcagaaggagctg
gaagcccagggcatgaagttcctgctgaccaagcagtcggaagccattctcggcaaaaag
cgggtcaaaagcctgctcttcgcggacggcagcacggcggaagccgatctgatcgtgatg
gcggtcggaatccggcccaataccgcgcttgcgaaaaagagcggcataaccgttaaccgc
ggtattgtcgtcaacgactatatggaaacgaatattccgggcgtttatgccattggggaa
tgcgcggagcaccggggcatcgcttacggtcttgtcgcaccgctgtatgagcagggtgcc
gtacttgccaaaaagctggcaggtgtcgaaacgcaaggctatgaaggatcggtcacctcg
accaagcttaaagtgtcgggcgtggatgtattctccggtggacaatacgaggagccggcc
ggatcgcgggcgctccgctatcaggatgaaatcggcggagtatacaagaagctcgttatc
cgtgaagacaagctcatcggcgcggtgttgttcggcgatacagcggacggagcgcagctg
ttctctctaattaagagcggcgaatcgattcagggcaaagaaagagcattgctgcttggc
ctgctggatgacgcggtgaaatcttctccgacggcccgcctcgaagcaatggcggatgat
gaaatcatctgcggatgcaacggcgtatccaagggagccatcgcagaagccattacaagc
ggcggctgcacaagtgtagggcagatcaaggcctgcacgaaagcgtcggcttcctgcgga
ggctgcaagccattggtagaagggctgctggagctgtatgcgggcgatgctgcggtcaag
gtcaaggaaggcatttgcggctgtaccacgcttagccgggacgaaatcgttgcggaaatc
aagcgaatggagctcaagagtgtcaaggaagtcatgaatgtgctggaatggaacaatgag
gagggctgctcgaaatgccgtccttccctgaactattatctcggcatgctgtggccggaa
gaatatgtggatgagaaagaatcccggatcacgaatgaacgctttcacgcaaacattcag
aaggacggaacgtactccgtcgttccccggatctacggcggcgtcacttccccggctgag
ctgaagaagattgccgaggttgcagagaaattcgacgttccgttggtgaagttcacggga
ggccaacggcttgacctgctcggcatcaaaaaagaggacctgccgaaaatctgggaagag
cttgacatgccttcgggacatgcatacggcaaaacgctgcgtacggtcaagacctgcgtc
ggatcgaccttctgccggtttggcacccaggactctattgcgatgggcatccgtctggag
aaggaatttgagcggctgaatacgccggccaaggtcaagcttgccgtctccggctgtccg
cgaaactgtgcggaagcgacgatcaaggattttggcgttgtcgcaatagacggaggctgg
gagctgcatgtcggcggcaacggcggcgtgcatgtccgggcgacggatctgctctgcgta
gtgaagacagaggatgaggttgtcgagtgggcaagcgcgttccttcaatattaccgtgaa
aatgccggctggaacgaaagaacctcgacttgggtggagcgtgtcgggctggacagcatc
aagaaggcgcttgaggaaagagaagagcggcttgcgctgcaggaaagaatccagacagcg
ctcagcgtgaccaccgatccgtggaaggagatcgtatctaacaaaaagcttcgcaaaaat
ttcgagccgatctctcggaccgagacggtataccaggagggctaa

DBGET integrated database retrieval system