KEGG   Paenibacillus sabinae: PSAB_20145Help
Entry
PSAB_20145        CDS       T03064                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
psab  Paenibacillus sabinae
Pathway
psab00010  Glycolysis / Gluconeogenesis
psab00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:psab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSAB_20145
   00500 Starch and sucrose metabolism
    PSAB_20145
Enzymes [BR:psab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PSAB_20145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AHV98920
UniProt: X4ZR37
LinkDB All DBs
Position
complement(4386039..4387454)
Genome map
AA seq 471 aa AA seqDB search
MSLQFPEGFLWGGAVAANQLEGAYQKDGKGWSTQDVMPHGVKTPPTEVPTDDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRTSIAWSRIFPKGDELEPNEQGLQFYDALFDECHRYGIEP
LVTISHYETPLHLAREYDGWVNRKLVDFYARYARTIFTRYKDKVKYWLTFNEINSILEFP
FMSGGISTPKEKLGKQELYQAIHHEFVASALAVKIGHEINPDFQIGCMVLSMPIYPLTPH
PDDVIKTMESDHKNTFFADIHARGYYPGYMKRFFKENGIQIHFEPGDEAILKHTVDFISF
SYYMSICETADPEKQIRGEGNLLGGVPNPYLEASDWGWQIDPKGLRCIMNAFYDRYQKPL
FVVENGLGAVDRLVTDENGDKTVEDGYRIQYLRDHLVQVAEAIADGVEVLGYTSWGCIDL
VSASSAELKKRYGFIYVDRHDDGSGTLERYRKKSFHWYKEVIATNGQSLFK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgcaatttccggaaggctttttatggggcggcgcggttgccgcgaaccagctg
gagggggcttatcagaaagacggcaaagggtggtccactcaggacgtcatgccgcatgga
gtcaagacgcctcccacggaagtccctacagacgataatatgaagctgatcgggatcgat
ttttatcaccggtataaagaggatatcaagctgtttgccgaaatgggcttcaaggtgttc
cggacgtccatcgcctggtcccggattttcccgaaaggggacgagctggagccgaacgaa
caaggcctgcagttctacgacgccctgttcgacgagtgtcatcggtacggcatcgagccg
ctggtcaccatttctcattatgagaccccgctgcacctcgcaagagaatacgacggatgg
gtgaaccgcaagctggtcgatttttatgcgcgttatgcgagaacgatttttacccgttac
aaggacaaggtgaaatattggctgacctttaacgagatcaattccattctggaatttccg
tttatgagcggcggaatcagcaccccgaaagagaagctgggcaagcaggagctgtaccag
gcgattcaccatgagttcgtggccagcgccctggccgtaaagatcgggcatgagatcaat
ccggatttccaaatcgggtgcatggtgctcagcatgccgatttatccgcttactccgcat
ccggacgatgtgatcaagaccatggagagcgatcacaaaaatacgttctttgccgacatc
cacgccagaggctattacccgggctatatgaagcgtttcttcaaagagaacggcatccaa
attcatttcgagccgggagacgaagcgattctgaagcataccgtggatttcatttcgttc
agctattatatgagcatctgcgaaacggccgacccggaaaaacagatccggggggaaggc
aaccttctaggcggggtcccgaatccgtatctggaagccagcgattggggctggcagatt
gaccccaagggtctgcgctgcatcatgaacgcgttctacgaccggtaccagaagccgctg
tttgtcgtcgagaacgggcttggcgccgtcgaccggctcgtaacggatgagaatggcgac
aagacggtggaggacggttaccgtattcaatatttgcgggatcatctcgttcaggtcgct
gaagccattgccgacggcgtggaggtcctagggtatacgagctggggctgcatcgatctt
gtcagcgcgtcaagcgccgaactgaagaaacgctacggcttcatctatgtggaccgtcat
gacgacggctcgggaacgcttgagagataccgcaagaagtcgtttcactggtacaaggaa
gtgatagcaacgaatgggcagagcctgttcaaatga

DBGET integrated database retrieval system