KEGG   Paenibacillus sabinae: PSAB_20645Help
Entry
PSAB_20645        CDS       T03064                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
psab  Paenibacillus sabinae
Pathway
psab00970  Aminoacyl-tRNA biosynthesis
psab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSAB_20645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psab03029]
    PSAB_20645
Enzymes [BR:psab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PSAB_20645
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PSAB_20645
Mitochondrial biogenesis [BR:psab03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PSAB_20645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AHV99020
UniProt: X4ZRC7
LinkDB All DBs
Position
complement(4501643..4503082)
Genome map
AA seq 479 aa AA seqDB search
MSSSKYETVIGLEVHVELHTKSKIFCGCSTEFGAPPNTQTCPVCLGHPGVLPVLNRQAVN
YAIKAAMALNCTISDVSKFDRKNYFYPDLPKAYQISQFDQPIGLNGWIDIEVNGETKRIG
ITRLHLEEDASKLTHVDGGFGTLVDFNRGGTPLIEIVSEPDLRSPEEARAYLEKMRAIIQ
YCDVSDVKMEEGSMRCDANISLRPVGQKEFGIRAELKNMNSFRGVQRGLEYEEFRQADIL
DGGGEVVQETRRWDDAQGKTFSMRGKEEAHDYRYFPDPDLIVLHIDDAWKEAIRSSIPEL
PDARRVRYSEEFGLPAYDAGVLTASKPIADFFEGSLNFTSDAKAVANWIMGDLLAYLNGN
NLELSEVKITPQGLGEMIGLIEKGTISSKIAKTVFKEMIESGKLPAKIVEEKGLVQISDE
GAIKGIVEAVVAANPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPGLVNKLLTEVLNS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatccaagtatgaaacagttattggactggaggttcacgtcgagcttcatacc
aagtccaaaattttctgcggctgctccacggagttcggcgcaccgccaaatacgcaaacc
tgtcccgtctgcctgggacatcccggggtgctgcccgtgctgaaccgccaggcggtaaac
tatgcgataaaagccgcaatggcgctgaactgcacgatcagcgatgtcagcaagtttgac
cgcaagaactatttctatcccgacttgccaaaggcttaccagatttcgcagtttgaccag
ccgatcggcctgaacggatggatcgatatcgaagtgaacggtgaaacgaagcgaattggt
attacccggcttcatctggaagaggatgccagcaagcttacacatgtagacggcggattc
ggcacgctcgtcgactttaaccggggaggaactccgctgattgaaatcgtctccgagccg
gatttgcgctcccctgaagaagcccgcgcttatctggagaagatgcgggcgattatacag
tactgcgacgtatccgacgtcaagatggaagaaggatccatgcgctgcgatgcgaacatc
agcctgcggcccgtgggccagaaggaattcggcatccgcgccgagctgaagaacatgaac
tccttccgcggcgtgcagcgcggtctggagtatgaggagttccgccaagcggatattctc
gatggaggcggcgaagtcgtgcaggagacccgccgctgggatgacgcccagggcaagact
ttttccatgcggggcaaggaagaagcccatgactaccggtattttcccgatccggacctg
attgtgctgcatattgatgatgcttggaaggaagccatccgttcttccattcccgagctt
ccggatgcgcggcgggtccgctacagtgaagaattcggtctgcccgcatacgacgcaggg
gtactcaccgcatccaagccaattgccgatttctttgagggaagcttgaatttcaccagc
gatgccaaagccgtcgccaactggattatgggcgatctgctcgcctatctgaacggaaac
aatttggagctgtctgaggtgaagatcacgccgcaggggcttggcgagatgatcggattg
atcgagaagggcaccatcagcagcaaaattgccaaaacggtgttcaaagagatgattgaa
tccggaaagcttccggcgaagattgtggaagagaaggggcttgtgcagatcagcgacgaa
ggagcgatcaaggggattgtggaagcggtcgttgcggccaacccgcaatcggtcgaggac
tataaggccggcaaacagaaagcaatcggcttcctggtcggacaagtcatgaaagaaagc
aaaggcaaggccaatccggggcttgtcaacaagcttctgacagaagtattgaacagctaa

DBGET integrated database retrieval system