KEGG   Paenibacillus sabinae: PSAB_22325Help
Entry
PSAB_22325        CDS       T03064                                 

Definition
(GenBank) flagellar hook-associated protein flgk
  KO
K02396  flagellar hook-associated protein 1 FlgK
Organism
psab  Paenibacillus sabinae
Pathway
psab02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:psab00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    PSAB_22325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:psab02035]
    PSAB_22325
Bacterial motility proteins [BR:psab02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    PSAB_22325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod DUF1664
Motif
Other DBs
NCBI-ProteinID: AHV99352
UniProt: X4ZQG0
LinkDB All DBs
Position
complement(4860016..4861620)
Genome map
AA seq 534 aa AA seqDB search
MTSTFHSIETARRSLVTQTAALNTTGHNIANANTEGYTRQSVKMAAARPIEAYGFSNSTS
PGQLGTGVEFGSIERIRETFLDDQFRGENSSLGSWTIQSDTLDKLESIFNEPSETGISTV
LDNFWKSWSDLSKNPEDSTARKIVVQTSQSMADALNYMSRQLDNLDTDLATNISVKATEI
NGYLSSIADLNESIFRIESMGDKANDLRDQRDLMTDKLSKIININVSRTDSGYNISLGGQ
QLVQGFAASSVSSDSLAEAYGDGVTGDLKSGEVYGMIDSSKRYVADYKTQLNNMANTIAT
GAVEITLPKGSVMPAGTILTNDASIIQADGTTVTLAAGDAMPPGATLNADVKTTVNGLNG
LHQLGYTLDGSLNPGKPLFTITGDGSTITAGNITFNPEIAANTDLLATSLRTTGTGASEK
VVKGNNTLALLIANQHSGIFTAPTGIKGTPNTFYKTMVGQLGVQSQEATRQTENSNYLVQ
QVDARRQSVSGVSLDEEMSNMLVFQHAYSAAARFMTTYDEMLDKLINATGTVGR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcaaccttccactcaattgaaaccgcccgccgaagcctcgtcacgcagacggcg
gcgctcaacacaacgggacataatatcgcaaatgccaacactgaaggctacacacgccaa
tctgttaaaatggccgctgccagaccgattgaagcttacggtttcagcaactccacttct
ccggggcagcttggcacaggggtggagtttggatccatcgagcggattcgggaaactttt
cttgacgaccagttccgcggagagaattcctcgctgggcagctggaccattcaatccgat
acgctggacaagctggagtcgatttttaacgagccttcggagactggaatcagcaccgta
ttggataacttctggaaatcgtggtccgacctcagcaagaatccggaagacagcaccgca
cgcaaaatcgttgtccagacctcccagtcgatggcggacgcgcttaattatatgagcaga
cagctggataatctggataccgatctggcgaccaatatctccgttaaagctactgaaatc
aacggctatctatcctcgattgcggaccttaatgagtccatattccggatcgagagcatg
ggtgacaaggctaacgatcttcgagaccagcgcgacttgatgacagacaagctgtccaaa
atcatcaatatcaacgtgtcccgaaccgacagcggctacaatatttcccttggaggccag
cagcttgttcaggggttcgcggcttcgtccgtatcctcagattcgctggccgaagcctat
ggagatggcgtgaccggcgatctgaaatccggcgaagtatacggaatgatagactccagc
aagaggtatgtggccgactataagacccagcttaacaacatggccaatacaattgctaca
ggagcggtcgagattacgcttccaaagggctccgtaatgcctgcgggaacgattttgacc
aacgatgcttcgattattcaggcggatggtacaactgtgactttagccgccggtgacgca
atgccgccgggagccaccctgaatgcggacgtcaagacaacagtgaatggacttaacggg
ctgcaccaactaggctatacgctggacgggagcctgaacccaggcaaaccgctgtttacc
ataaccggtgacggcagtacaattaccgcggggaatattacatttaatcctgaaattgcc
gccaataccgatctgcttgccacatctcttcgtacgaccggtacaggagcctcggagaaa
gttgttaaaggaaataatacgctggcattattgattgccaaccagcattccggaatattt
actgcgccgactggaattaagggcactcccaacactttttataaaactatggttggacag
cttggtgtacaatcgcaagaagcgacccgtcagacggagaactccaactatctggtgcag
caggtggatgctcgccgccaatccgtgagtggtgtttctctagacgaagaaatgtccaat
atgctcgtgttccagcatgcctatagcgccgccgcgcgttttatgacgacctatgacgaa
atgcttgataaactcattaatgccaccggcaccgtcggcagataa

DBGET integrated database retrieval system