KEGG   Proteiniphilum saccharofermentans: PSM36_0602Help
Entry
PSM36_0602        CDS       T04672                                 

Definition
(GenBank) putative bifunctional UDP-N-acetylmuramoyl-tripeptide
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
psac  Proteiniphilum saccharofermentans
Pathway
psac00473  D-Alanine metabolism
psac01100  Metabolic pathways
psac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSM36_0602
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PSM36_0602
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psac01011]
    PSM36_0602
Enzymes [BR:psac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PSM36_0602
Peptidoglycan biosynthesis and degradation proteins [BR:psac01011]
 Precursor biosynthesis
  Racemase
   PSM36_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase
Motif
Other DBs
NCBI-ProteinID: SCD19432
UniProt: A0A1R3T045
LinkDB All DBs
Position
I:780390..782858
Genome map
AA seq 822 aa AA seqDB search
MQYSIQEIGTILGVPVNKEGSDKISILLTDSRKLALPAETLFFALETKNNDAHIFIGELY
EKGVRNFVVSKTFPEWADFGDANFLKVKNSLSALQKIAAYHRKRFNIPVIGITGSNGKTI
VKEWLYQILEKDYNIVRSPRSYNSQIGVPLSVWQLDDDSQLGIFEAGISQPEEMGKLEPV
IRPTIGVLTKIGEAHQENFVSLQQKIMEKLELFVNCDVFIFDEDNHLVAECVDQMVLSQK
TFTWSRKSRDAHLYISAVKKKGEKTVINYSFLDFDDSFTIPFTDEASIENAISCLAVALY
LHISPTGISSRMAILEPVAMRLDVRKGKENCIIINDTYNSDINSIKIALDFQQQRKVDRH
LKKTLILSDILQAGIPPGSLYKKVAGMIEQSGVERVIGIGRDITTHQDLFSTPEKSFYLT
TDQFISSGEWKNFDHELILLKGARRYHFEQIGALIEERIHETLLEVDLDAVVHNFNFYKS
RLLSDIKLVCMVKANGYGAGAVEIAKTLQYHRCDYLAVAVAEEGIQLRKEGISLPLIVLN
PEVNGFEELFNADLEPEVYNFRILEAFIKESERRGITDYPIHLKIDTGMHRLGFLPEQIP
DMLSVLKKQKGLKVISVFSHLSASESWHFDDFTHRQMEIFRKAAEEIEQAFNYPVYKHIL
NSAGMERFSDTKWDMTRLGIGLYGISASGLPGLKNVCTLKTTILQIKHISSNETIGYGRK
EKLERDARIATIRFGYADGLDRQFGNRKGKVLINGQYAPIVGNVCMDLCMVDVTGIKAEE
GDTVILFGENLSVIELAESIGTIPYEILTSVSPRVKRIYIKE
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacagtattcaagagatagggactatattaggtgtaccggtcaataaggaggga
tcggataaaatatcgattttgcttaccgacagccgtaaattggcattgccggctgagacc
cttttttttgcgttggaaacaaaaaataatgatgcacatatttttataggtgaactgtat
gaaaagggtgtacgtaattttgtagtatctaagactttcccggaatgggcggattttgga
gatgccaatttcctgaaagtgaaaaacagtttgtcggcactgcagaagatcgcagcttat
cacagaaagagattcaatatacctgtcattggaattaccggtagcaatgggaaaactatt
gtaaaagaatggctttaccagatactggagaaagattacaatattgtccgttcacccagg
agttataattcccagattggtgtgcctctctcggtctggcaattggatgatgattcgcag
ttgggtatttttgaagcgggtatatcgcagccggaagagatgggcaaactggagcctgtt
atccggcctactattggagtattgacaaaaataggggaggcgcatcaggaaaattttgtc
tccttgcagcagaagatcatggagaaactggaactttttgtcaactgcgatgtgtttatt
tttgatgaggacaaccacctggttgccgagtgtgtcgatcagatggtgctttcccagaaa
acctttacctggtccagaaaaagcagggatgcgcatttgtatatatctgcggtgaaaaag
aaaggggagaagacggtaatcaactattcattcctggattttgatgactccttcacaatc
ccttttaccgatgaggcttcaattgagaatgccatcagttgtcttgccgttgcactttac
ctgcatatttcacctacaggtatctcctccaggatggctattcttgaacctgtagctatg
cgattagatgtccggaaaggaaaagaaaactgcattattataaatgacacctataactct
gatatcaattccattaaaattgcacttgatttccaacaacagcgtaaggttgaccggcat
ttaaagaaaacattgatcctttccgatatacttcaggcgggaattcctccgggatccctt
tataaaaaagtggcaggaatgatagaacagagtggtgtagaaagagtgataggcataggc
cgggatatcacaactcaccaggatctgttttcaacgccggagaaatctttttatttgaca
acagatcagtttatctcttccggagagtggaaaaatttcgatcatgagttgattttgctg
aaaggtgcacgtaggtaccattttgaacagattggagctcttattgaggaacgtatacac
gaaactctgctggaggtcgatctggatgccgtagtacataatttcaatttttataaatcc
cgcttgttatcagatataaaactggtctgcatggtaaaagcgaacggatatggtgcgggt
gctgtggagattgccaaaacacttcaataccatcgttgtgattacctggcagtggctgta
gccgaagaaggaatacaactcaggaaggaagggatttcattgccattgatagtattgaat
cctgaagtgaacggtttcgaagagctctttaacgcagatttggaaccagaagtatacaat
ttccgtattctggaggcgttcattaaggagtcggaacgaagaggcatcacagattatccg
atccatttgaagatcgataccggaatgcatcggttgggttttcttccggaacagatacct
gatatgttatccgtgctcaaaaaacaaaaaggattgaaagtgatatctgtattctcacac
ttatctgcaagcgaaagctggcattttgatgattttactcaccggcaaatggagatattc
aggaaggcagcagaggaaatagagcaagcattcaattatcccgtctataagcatatactc
aactcggctggtatggaacgtttctctgataccaaatgggatatgacccgtcttggaatc
ggactatatggtatcagtgctagcggtttgccgggtcttaaaaatgtctgtaccctgaag
acgactattctacagatcaaacatatctcctctaacgagactataggttacggaagaaaa
gaaaaactggaacgggatgcacgcatcgccacaatacgttttggttatgcagatggattg
gatcggcaattcggcaaccgtaaaggaaaggttctgattaacgggcaatatgcacctatt
gtagggaatgtctgcatggatctctgcatggtggatgtgaccggcattaaagcagaggaa
ggtgacacggttatcctgtttggtgaaaatctatcggtgatcgagttggctgagagtatc
ggtactatcccctatgaaatacttacctctgtgtctcctcgtgttaaacgtatttacata
aaagaatag

DBGET integrated database retrieval system