KEGG   Proteiniphilum saccharofermentans: PSM36_1763Help
Entry
PSM36_1763        CDS       T04672                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psac  Proteiniphilum saccharofermentans
Brite
KEGG Orthology (KO) [BR:psac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSM36_1763 (ahpF)
Enzymes [BR:psac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSM36_1763 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 HI0933_like GIDA FAD_oxidored Thi4 Thioredoxin_3 AlaDh_PNT_C DAO NAD_binding_7 K_oxygenase Glutaredoxin FAD_binding_3 Lycopene_cycl NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: SCD20581
UniProt: A0A1R3SYK3
LinkDB All DBs
Position
I:complement(2230143..2231696)
Genome map
AA seq 517 aa AA seqDB search
MLDTSLIEQLRGIFSELSNDYTFDVSVRENHPNRGQLLELLNDVVSVSDRLSLQENPGEG
LAFDILKNGEKTGIRFRAVPTGHEFTSLLLAVLNADGKGKNLPDEFVTKRLKSLKGDIRL
TTYMSLTCTNCPDVVQTLNAMAVINPRITHEAVDGAIYKEEADALDLQGVPAVFADGELL
HVGRGNFGELLAKLEAHYGTETSEVEEQTIREYDVIVVGGGPAGVAAAVYSARKGLNVAV
VAERVGGQVNETGGIENLISVPRTTGSKLADDLKNHMSEYPIDIFEHRSVENVTVENKQK
IVLTQGGEIFTAPALIIATGASWRKLNVPGETEFIGRGVAFCPHCDGPFYKGKRVAVIGG
GNSGIEAAIDLAGICSHVTVFEFLEELKADKVLQEKVKSLPNVEIFLHSQTTEVINNGEK
VTGLKVKDRKTEEERVIDLDGVFVQIGLAPNSAAFKDVVKTNRFGEIEIDERARTDVPGI
YAAGDVTTVPYKQIIISMGEGAKAALTAFDDRIRGVI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctagatacatctttaatagaacaactacggggtatcttctcggaactcagtaatgat
tacacattcgatgtttcggtcagagaaaaccatccaaaccgtggacaactgctcgaacta
ctcaacgacgtggtatcggtttcggatcgtctgtcattgcaggaaaatccgggtgaaggt
ctcgcattcgatatattgaaaaacggtgagaaaacgggaatcagattccgtgcagtaccg
accggccatgagtttacctcactgctgctggctgtcctgaatgcggatggtaaaggtaag
aacctgcccgatgaattcgtaacgaagagattgaaatcgttaaagggagatatccgtctg
acaacttatatgtcgctgacctgtaccaattgtccggacgtggttcagactctgaacgcc
atggcggtgatcaacccgcgtattacgcatgaagcggtggatggcgctatctataaggag
gaagcagatgctctggatctgcaaggagtgccggcagtttttgccgatggcgaactttta
cacgtcggccggggaaatttcggcgaattgctggctaaattggaagcgcattatggtacg
gagacatccgaagttgaagaacagaccatccgcgaatatgacgtgattgtggtaggcgga
gggcctgccggtgttgcagcggctgtctacagtgcccgtaaagggttgaatgtggctgtt
gtcgccgaacgtgtagggggccaggtcaatgagacgggagggatagagaatctgatctcg
gttcccaggacaaccggcagcaaattggcagatgatcttaaaaaccatatgagcgaatat
cctatcgatattttcgaacatcgttcagtcgagaatgtaacagtggaaaataaacagaag
atcgtcttgacccagggtggtgagatatttaccgcacctgcgttgatcattgctacagga
gccagctggcgcaagctgaacgtgcccggtgaaaccgagttcatcggaagaggggtggct
ttttgtccgcattgcgacggtccgttctataaaggcaagcgtgtggcagtaataggcgga
ggtaactccggtatagaggcggctatcgacctggcagggatatgttctcacgtcaccgtt
tttgagttcctggaagaactgaaggcggacaaggtattacaggagaaggtgaaaagcctg
ccgaatgtagagatcttcctccactcgcaaacgaccgaagtgatcaacaacggagaaaaa
gtcaccgggttgaaggtgaaagaccgcaagacggaagaagaacgggttatcgacctagac
ggggtatttgtacagatcggtctggcgcccaacagcgcagcgtttaaagatgtggtaaag
accaaccgtttcggagagatagagatcgacgaacgcgcacgtacggacgtccccgggatt
tatgctgccggcgacgtaacgacggttccctacaagcagatcatcatttctatgggagaa
ggcgcgaaggcagctctgacggcattcgacgacaggatccgcggggtgatttga

DBGET integrated database retrieval system