KEGG   Proteiniphilum saccharofermentans: PSM36_2312Help
Entry
PSM36_2312        CDS       T04672                                 

Definition
(GenBank) putative Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
psac  Proteiniphilum saccharofermentans
Pathway
psac00500  Starch and sucrose metabolism
psac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM36_2312
Enzymes [BR:psac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PSM36_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 Ependymin
Motif
Other DBs
NCBI-ProteinID: SCD21117
UniProt: A0A1R3T947
LinkDB All DBs
Position
I:2911184..2912521
Genome map
AA seq 445 aa AA seqDB search
MKTICIYFQLHQPFRLKRYRFFNIGRDHYYFDDYANEDILQQIATRSYVPANRMLLDLVN
QYKGKFKVAFSISGVALEQLEIYAPEVIDGFRELAKTGSVEFLTETYAHSLASLYDPEEF
RNQVKHHSDRMEMLFEQKPTVLRNTELIYSDEIAEMVYDMGYSKMITEGAKHILGWKSPN
YVYQAATQPKLKLLLKNSRFSDDIAYRFSNYSWNEYPLTAEKFISWIAGTPAEEEVVNLF
MNYETLGNLQPSYTGIFEFFKAMPRFAFENGIGFATPGEALDMHKPIGAINVPNPISWTD
EERDLSAWVGNKLQKSALQSMYEIGERVRLCTDRRLKQDWLYLQTSDHFHYMSTKHFGGG
QSQFSPYMSPYDAFNNYMNVLSDFIGRVKAQYPDTVDNEELNALLTTIHNQEMEIKRLQA
ELKKVIGTNEEMLVEKNPKAQKAEN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaatttgcatttatttccagctccatcaaccattccggttaaagagataccgc
tttttcaatatcggcagggatcattactatttcgatgactatgccaacgaagatatactg
caacagattgctacccgatcgtacgtccctgccaaccgcatgttgctcgatctggtcaat
caatataagggaaaattcaaagtggctttttctatctcgggtgtagccttagaacaactc
gaaatttatgcaccggaggtgatagacggttttcgcgaactggccaaaaccggaagtgta
gaatttctgacggaaacctatgcccattcactggccagcctttacgaccctgaagagttc
cgcaatcaggtaaaacatcattccgataggatggagatgctttttgaacagaagccgacc
gttctccgtaatacggaactgatctactccgatgagattgctgagatggtatatgatatg
ggatattcgaaaatgatcaccgaaggtgccaaacatatattgggatggaagagtcctaat
tatgtctatcaggcagccacacaaccaaaactgaaattgttgctcaaaaacagtcgtttc
agcgatgacatagcctatcgtttttcgaattatagctggaatgagtatccgctgacggca
gagaagtttatctcatggatagccggtactcctgccgaagaagaggtggttaacctcttt
atgaactatgaaacactcggcaacctccaaccatcatacaccggtattttcgaattcttt
aaagcaatgccccgctttgcttttgagaacgggatcggatttgccacgccaggagaggca
ttggacatgcataaacccattggcgccatcaacgtccccaatcccatctcatggacggat
gaggagcgagacctgagtgcatgggtaggaaacaaactccaaaagagcgcattacaatca
atgtatgaaataggagaaagggttcgtttatgtactgaccgtcgcctcaaacaggattgg
ctctatttgcaaaccagcgaccatttccattacatgtctaccaaacattttgggggcgga
caaagccagttcagcccctacatgtcgccttacgacgctttcaacaattacatgaatgtg
ctgagtgattttattggccgtgtaaaagcgcagtatcccgatacagtcgacaatgaagag
ttgaacgcactccttactactattcacaatcaggagatggagattaaacgtcttcaggcc
gaactcaagaaagtgattggcactaatgaagagatgttagtggaaaagaatccaaaagca
caaaaagcggagaattaa

DBGET integrated database retrieval system