KEGG   Proteiniphilum saccharofermentans: PSM36_2930Help
Entry
PSM36_2930        CDS       T04672                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
psac  Proteiniphilum saccharofermentans
Brite
Translation factors [BR:psac03012]
 Eukaryotic Type
  Elongation factors
   PSM36_2930 (tuf)
 Prokaryotic Type
   PSM36_2930 (tuf)
Mitochondrial biogenesis [BR:psac03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PSM36_2930 (tuf)
Exosome [BR:psac04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PSM36_2930 (tuf)
  Exosomal proteins of breast cancer cells
   PSM36_2930 (tuf)
  Exosomal proteins of colorectal cancer cells
   PSM36_2930 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW CbiA Gtr1_RagA
Motif
Other DBs
NCBI-ProteinID: SCD21720
UniProt: A0A1R3T3G1
LinkDB All DBs
Position
I:3679882..3681069
Genome map
AA seq 395 aa AA seqDB search
MAKEHFSRTKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGFSEVRSFDSIDNAPEEKERG
ITINTSHVEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPKLVVFMNKVDLVDDEEMLELVEMEVRELLSFYNFDGDNTPVIQGSALGGLN
GDPKWEEKIMELMDAVDAWIPLPPRDVDKPFLMPVEDVFSITGRGTVATGRIETGIIKTG
EEVQIIGLGAEGKKSVVTGVEMFRKILDEGQAGDNVGLLLRGIDKDEIKRGMVISHPGKV
KPHSKFKAEVYILKKEEGGRHTPFHNKYRPQFYIRTLDVTGEIQLPEGVEMVMPGDNVTI
EVDLIYPVACHVGLRFAIREGGRTVGAGQITELID
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaacatttttcccggacgaaaccgcatgtgaacatcggtacaatcggccac
gttgaccacggtaaaaccactttgacggctgctatcacaaccgttttagcaaaaaaaggt
ttctctgaagtacgttcgttcgattccatcgacaacgctcccgaagaaaaggaaagaggt
atcaccattaatacttctcacgttgaatatgaaactgcaaaccgtcactatgcacacgtt
gactgccccggccacgctgactatgtgaagaacatggttaccggtgctgcccagatggac
ggtgctatcatcgtagttgctgcaaccgacggcccgatgccccagacacgtgaacacatt
cttttggcacgtcaggtaaacgttcccaagctggttgtcttcatgaacaaagtggacttg
gtagacgacgaagaaatgttggaactggttgaaatggaagtaagggaacttctttcattc
tataatttcgatggggacaatacgcccgttatccagggatctgctctcggtggattgaat
ggagaccccaaatgggaagaaaaaattatggagctgatggatgccgttgacgcatggatc
ccgctgcctccgcgcgatgtggataaaccgttccttatgccggtagaagacgtattctcg
atcactggtcgtggtacagttgctacaggccgtatcgaaacaggtatcatcaaaacagga
gaagaagtacagatcattggtctcggtgcagaaggcaagaagtcggttgtcaccggagtg
gaaatgttccgtaagatccttgacgaaggacaggctggtgataacgtaggtctgttgctc
cgtggtatcgacaaagacgaaatcaaacgcggtatggtgatctctcaccccggaaaagtg
aaacctcactctaaattcaaagccgaggtgtatatcctgaagaaagaagaaggcggtcgc
cacactcctttccataataaataccgtccccagttctacatccgtacactcgacgtaacc
ggagagatccagttgcccgaaggagtagagatggtaatgcccggtgataacgtaactatt
gaggtagacctgatctatccggtagcatgtcacgtaggtctccgtttcgctatccgtgaa
ggtggccgcacagtaggtgccggacagattactgagttaatcgactaa

DBGET integrated database retrieval system