KEGG   Pontimonas salivibrio: C3B54_11213Help
Entry
C3B54_11213       CDS       T05334                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
psai  Pontimonas salivibrio
Pathway
psai00010  Glycolysis / Gluconeogenesis
psai00030  Pentose phosphate pathway
psai00051  Fructose and mannose metabolism
psai00052  Galactose metabolism
psai00680  Methane metabolism
psai01100  Metabolic pathways
psai01110  Biosynthesis of secondary metabolites
psai01120  Microbial metabolism in diverse environments
psai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C3B54_11213
   00030 Pentose phosphate pathway
    C3B54_11213
   00051 Fructose and mannose metabolism
    C3B54_11213
   00052 Galactose metabolism
    C3B54_11213
  Energy metabolism
   00680 Methane metabolism
    C3B54_11213
Enzymes [BR:psai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     C3B54_11213
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     C3B54_11213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AVG23216
UniProt: A0A2L2BNH4
LinkDB All DBs
Position
complement(197211..198242)
Genome map
AA seq 343 aa AA seqDB search
MEGMRLGILTSGGDAPGLNAVIRGAVLTGERTAGHSFVGFRNGWQGVVEDDTMPLSRHQV
KGINKLGGTIIGTSRTNPYEHGGAERVKEVLAKNEVDALIVVGGEGSLAGAQELYKDGVP
IIGVPKTIDNDLGGTDYTFGFDTAVGIATEAMDRLRTTGESHSRCMVAEVMGRHVGWIAL
HSGLAVGAHLILIPERKTSMDEITHYVKGAYDRGRAPLVVVAEGFQLASMDTVHSELGLD
EAGRPRLGGIANLLAPLIDEATGIETRATTLGHIQRGGTPSAFDRVLATRFGMAAVHAAQ
ASQWGHMVSVRGTDIVVVGLEEAVGSLKVVPTERYDEAALLFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtatgcgcctaggaattttaaccagtgggggcgacgcccccggattaaacgcc
gtcatccgtggagcggtgctcaccggggagagaaccgccggacacagttttgtcggcttt
cgaaatggttggcagggagttgtcgaagacgacaccatgccacttagccgccaccaggtg
aaaggcatcaacaaactcggtggaacaatcatcggcaccagtcgcaccaacccgtacgag
catggcggcgctgagcgagtcaaagaagtactggccaaaaacgaggtggacgctctcatc
gtggtgggaggagaaggaagccttgccggtgcgcaagagctctacaaagatggagtgccc
attatcggcgtgccaaagactatcgacaacgacctgggtggcaccgactacacgttcggg
ttcgacactgctgtaggaattgcgaccgaagcaatggaccgactgagaaccaccggtgaa
tcccactctaggtgcatggtcgctgaagtaatggggcgccatgtggggtggattgctctt
cactcgggcctcgcagtcggcgcacacctcattctcattcctgagcgaaaaacctcgatg
gacgaaatcacccactacgtcaagggggcctacgaccggggtcgggcgcccctcgttgtg
gtggctgaaggtttccagttggcctcaatggacacagtgcactctgagctcggactcgat
gaagccgggcgaccacgtcttggcggcattgcgaaccttctggcaccgctcatcgacgaa
gcaaccggtatcgaaaccagggcgacaacgctcgggcacatccaacgcggtggaacaccc
agtgcgtttgaccgtgtactcgccacacgttttggtatggcagcggtgcacgccgcccaa
gccagtcagtggggccacatggtctcagtgcgaggcaccgacattgtggtggtaggactc
gaagaggccgtcggatcgctcaaagtggtccccacagaacgctacgacgaagccgccctg
ctcttcggttag

DBGET integrated database retrieval system