Pontimonas salivibrio: C3B54_11636 Help Entry C3B54_11636       CDS       T05334                                  Name (GenBank) thioredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism psai  Pontimonas salivibrio Brite KEGG Orthology (KO) [BR:psai00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     C3B54_11636 Enzymes [BR:psai01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      C3B54_11636 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin GST_N_3 Thioredoxin_9 Glrx-like GST_N Motif Other DBs NCBI-ProteinID:  AVG23621 UniProt:  A0A2L2BPM6 LinkDB All DBs Position complement(598238..598492) Genome browser AA seq 84 aa AA seqDB search MSEPTIEFYGAQWCGDCRRAQALMEHFGVDFNYHDIDASEADKARAIEISGLQKIPVLLF PDGSHLSEPSSPLLQEKLTELNLI NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtctgagcccacaatcgaattttatggagcccaatggtgtggcgactgtcgccgggct caagccttaatggagcacttcggtgtggatttcaattaccacgacatcgatgccagcgaa gccgacaaagcacgtgccatcgaaatcagcgggttgcagaaaattcccgtccttctcttc cccgacggcagtcacctgagtgaaccgtcaagcccgcttctccaggaaaagttgacagag ctgaatctgatttag

DBGET integrated database retrieval system