KEGG   Piscirickettsia salmonis: PSLF89_03505Help
Entry
PSLF89_03505      CDS       T03982                                 

Definition
(GenBank) hypothetical protein
Organism
psal  Piscirickettsia salmonis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1
Motif
Other DBs
NCBI-ProteinID: ALT18058
LinkDB All DBs
Position
complement(53111..53512)
Genome map
AA seq 133 aa AA seqDB search
MKKFGMVKVFRQKCSHSYRYYAVAMPKINMLTDFTDGDFERIHKAHWNIERFHRATKQLC
SIEKFQVRTTECIKNHIFCSFISFIKLECARISDIISNWYQLKKDLFIGVVRDFIIKGIE
AEEKSKLIPAVNA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaatttggtatggttaaagtgtttagacagaaatgcagtcactcatatcgctat
tatgctgttgctatgccaaaaataaacatgctgacagatttcactgatggggattttgag
cgtattcacaaagcccactggaatattgaacgttttcacagggcaaccaagcagttgtgc
agtattgaaaagtttcaagtgcgtacaacagagtgcataaaaaatcatatcttttgttca
tttattagttttataaagttagaatgcgctagaataagcgatataatttcaaattggtat
cagcttaaaaaagatttatttattggtgttgtcagagattttattataaaaggcattgaa
gcagaggaaaaatcaaaattaatccccgctgtcaatgcgtaa

DBGET integrated database retrieval system