KEGG   Piscirickettsia salmonis: PSLF89_1723Help
Entry
PSLF89_1723       CDS       T03982                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psal  Piscirickettsia salmonis
Pathway
psal00473  D-Alanine metabolism
psal00550  Peptidoglycan biosynthesis
psal01100  Metabolic pathways
psal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSLF89_1723
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSLF89_1723
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PSLF89_1723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psal01011]
    PSLF89_1723
Enzymes [BR:psal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PSLF89_1723
Peptidoglycan biosynthesis and degradation proteins [BR:psal01011]
 Precursor biosynthesis
  Amino acid ligase
   PSLF89_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST TTL CPSase_L_D2 ATP-grasp_4 YecM ATPgrasp_Ter ATPgrasp_YheCD RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AKP73567
LinkDB All DBs
Position
complement(1174913..1175914)
Genome map
AA seq 333 aa AA seqDB search
MIEKTTSLNIAVICGGSSMEAVVSRSSGSEVAKALKLNYPNSKIFELDNNIHTHLDKNKT
DLVFPVLHGPIGEDGTFQGFLEIINLPYVGNTVHASSYAMNKFIAKKFFENSNLPTIPGL
LYTACHSLDTTCHHALKALGENLVIKPCDQGSGLGVEFISGLNSLKKTLKASAQKYGSVL
IERQINGRELTVGILAVAGQSQLQAFPVIEIKTPENSWYDYKHRYTPGLSEHIIPASLSK
SLTDQLTQFAYSAHQSLGCRDLSRIDFLLDEQNTPFILEVNTMPGMTATSLYPEGAKAIG
IEFPELLSQLVENAWHRDSQQQINNIEKQTTTP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaaaacaacctcgctcaatatcgccgttatttgtggtggctcgtctatggaa
gcggttgtttctcgctcctcaggtagcgaagtcgcaaaagcattaaaattaaactatccg
aatagcaaaatattcgaattagataataatatccatactcatcttgataaaaataaaact
gatcttgtttttccagtattgcatggccctatcggtgaggatggcacattccaaggtttt
ttagagattattaaccttccctatgtcggtaataccgtgcatgcgtcctcatatgccatg
aataaatttattgctaaaaagttctttgaaaattctaacctacccactattcctggctta
ctctacacagcttgccattctctagacacaacttgccatcatgccctaaaagcattaggc
gaaaatctagtcattaaaccatgcgaccaaggctctggcttaggtgttgaatttatctct
ggtttaaactcccttaaaaaaacactcaaagcaagcgcacaaaaatatggttcagtccta
atcgaacgccaaattaatggccgcgaactcacagttggtattttagctgtagcaggtcaa
tctcaattgcaagcctttcctgttattgaaattaaaactcctgaaaatagctggtatgat
tataaacatcgctatactccagggctaagcgaacacataatcccagcctctctttctaaa
tcattgacagaccaactcactcaatttgcttatagcgctcaccaatctctaggctgtcga
gacttatcacgcattgattttttgcttgatgagcaaaatacaccatttattctggaagta
aataccatgccagggatgaccgcaaccagcctctaccctgaaggtgcaaaagcaatcggc
atagagttccccgagttattaagccaacttgtcgaaaatgcctggcacagagactcacaa
caacaaataaacaatatagaaaagcaaaccaccacaccctaa

DBGET integrated database retrieval system