KEGG   Piscirickettsia salmonis: PSLF89_2956Help
Entry
PSLF89_2956       CDS       T03982                                 

Definition
(GenBank) MFS sugar transporter
Organism
psal  Piscirickettsia salmonis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_2
Motif
Other DBs
NCBI-ProteinID: AKP74500
LinkDB All DBs
Position
2329408..2330799
Genome map
AA seq 463 aa AA seqDB search
MDTATHSKSSFFSLFITFFAAIGGILYGYDIGIINGALLYIQHDIHMSAAQTSFIVAAVL
GGGALSTLITGYLADRFGRKHMMITAVAIFLLGVAFLATAHNYNVLLVGRLIQGIGIGII
TIIIPLYLSEVAPKHLRGRGVCSFQVLLSAGILLANVIAYFFAKAGISWHMMFLSSGIPA
VILATGLLFLPKSPRWLVFKGHIQQARQTLEQVYPKKTASQELELIRSSHNQSSTASISA
LFQRKFIYPLTLVFSIAILNQLTGINSILQFSATLLKGAGLHSDLVAILGSIWITVVNFI
ITIIAMLLVDKVGRKPLLIIGTAGVTVALLLSGIAFIYLPEGMTKGLLIGIGLLVYVFFF
ALGPGIVVWIALSELLPNSIRSIGMAVALSLNSLASTLLASSFLPLVNHIGYGGIFILCG
FFTAIYFYLAYFKMPESKGKSLEEIESSYNTAAQPATATLHIK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggatacagcaacacactcaaaatcatcttttttttcattatttattaccttttttgcc
gcaatcggcggcattctttatggctacgatatcggcattattaacggcgcactactctat
atacagcatgatattcacatgtcagcagcgcaaacatcatttattgtcgccgccgtgctc
ggtggtggtgcattatcaaccttaatcacgggctacttggccgaccgctttggccgtaaa
cacatgatgatcacagcggtcgctatcttcctccttggcgttgcttttctagcaactgca
cacaactacaacgtattactggtcggccgactcattcaaggcattggtattggcattatc
actattatcattccactttatctcagtgaggttgctcccaaacatctacgtggacgcggt
gtttgctcctttcaagtactattaagcgcgggcattctactggccaatgtcattgcttat
ttttttgccaaagcgggaatcagctggcatatgatgttcttaagctcaggcattcctgcc
gtgattttagctacaggcttactcttcttgcctaaatcaccgcgctggctagtatttaaa
ggtcatattcaacaagcccgccaaactcttgagcaagtctaccctaaaaaaacagcttca
caagaattagagcttatccgcagcagccataatcaaagtagcacggcctcaatcagcgct
ctttttcagcgtaaatttatttacccactgacgcttgtctttagcattgctattttaaac
caactgactggcattaattctattttgcaatttagtgcaacactcttaaaaggcgctggc
ttacactctgatcttgtggcaattttaggcagtatctggatcaccgtcgttaatttcatt
attaccattattgccatgttattagtcgataaagtcggcagaaagcccttattaattata
ggcactgcgggagtcacggtcgctttattattatcaggcattgcatttatttacctgcca
gaaggcatgacaaaaggactactcattgggataggcttactcgtttatgttttcttcttt
gcgctgggcccaggtatcgtggtctggattgccctctctgaactattgcccaactcaatt
cgcagcattggcatggcagttgcgctctcactcaactcactcgcatccaccttactggct
tccagcttcttacccttagtcaaccacatcggctatggcggcatttttatactctgtgga
ttctttactgcaatttacttctatcttgcttactttaaaatgcctgagtcaaaaggcaaa
agcctagaagaaattgaaagtagttacaacacagctgctcaaccggcaacagccacactg
catattaagtaa

DBGET integrated database retrieval system