KEGG   Piscirickettsia salmonis: PSLF89_3189Help
Entry
PSLF89_3189       CDS       T03982                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psal  Piscirickettsia salmonis
Pathway
psal00010  Glycolysis / Gluconeogenesis
psal00020  Citrate cycle (TCA cycle)
psal00620  Pyruvate metabolism
psal01100  Metabolic pathways
psal01110  Biosynthesis of secondary metabolites
psal01120  Microbial metabolism in diverse environments
psal01130  Biosynthesis of antibiotics
psal01200  Carbon metabolism
Module
psal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSLF89_3189 (aceF)
   00020 Citrate cycle (TCA cycle)
    PSLF89_3189 (aceF)
   00620 Pyruvate metabolism
    PSLF89_3189 (aceF)
Enzymes [BR:psal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSLF89_3189 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_D23 GCV_H NQRA HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AKP74685
LinkDB All DBs
Position
198386..200302
Genome map
AA seq 638 aa AA seqDB search
MATMKDVLVPDIGNYSDVAVIEINVAVGDQVSADDALITLETDKATMEVPAPFAGTVKAI
KVKEGSKVSEGSLIVQMEGSDDVVESATVPAPVAAPTAVVAPTGPIEVRVPDIGNYSGVD
VIEINVAVGDQVSEEDALITLETDKATMEVPSPVAGIVKEIKVAEGSQVSEGDLVLIVEG
AGGTSAVAHPPATAQQEVTTISSAVPMAAVASASVQEVHVPDIGNYSGVDVIEINVAVGD
CINEEDPLITLETDKATMEVPSPVAGVVKEIKVAEGSQVSEGDLIVLVESPGASSVVVSS
VASQGAAVAVPAANQPVTSVASAAAPVLTQASGPSHASPALRRFANELGVDLAKVIGTGR
KNRILHEDVTKWVKNTLSRPAATASAGGGTGLDLLPVPKVDFAKFGAIEEQPLSRIKKIS
GANLHRNWVMVPHVTQFDEADITEMEAFRKEQNKLAEKKKADYKFTPLAFLLKASAAALK
AFPEFCASLNEVADALVLKKYVHIGVAVDTPNGLVVPVVQNVDQKGLVELSRELGEISKK
ARAGKLTAVDMQGGCFTISSLGGLGGTAFTPIVNLPEVAILGVSKSSIKPIWNGNDFAPR
LMLPLSLSYDHRVIDGAAAARFTTFLAEQLSDLRNMLL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacgatgaaagacgtattggtgccggatattggtaactatagcgatgtagccgtc
attgaaattaatgttgctgttggtgatcaggtgagcgctgatgatgcattgattacactt
gaaacagacaaggccactatggaagtccctgcaccgtttgcagggactgttaaagcgatt
aaagtgaaagaaggcagtaaagtctctgaaggtagcttaattgtacagatggaaggctct
gatgatgtggttgagtctgctacagtgcctgcgcctgtcgcagcaccgacagcggtcgta
gcaccgacaggtccaattgaagtgcgtgtacctgatattggtaattacagcggtgtggat
gtgattgaaatcaatgttgctgtcggtgatcaggtcagtgaagaagatgctttaatcacc
ttggaaactgataaagcgacaatggaagtaccatcgccggtggcgggtatcgttaaagaa
attaaagtcgctgaaggcagtcaagtctctgaaggtgacctagttttaatcgttgaaggt
gccggtggtacgagtgcggtagcgcatccccctgctactgcacaacaggaggttacaaca
ataagctcggcggtgccgatggctgctgttgcgagtgcaagtgtacaagaagtgcatgtg
ccggatattggtaactacagcggtgtggatgtgatagagatcaatgttgccgtgggtgat
tgcattaatgaggaagatccactgattactctggaaactgataaggcgacgatggaagta
ccatcgccggtggcgggtgttgttaaagaaattaaagtcgcggaaggcagtcaagtctca
gaaggtgatttaattgttttagttgaatcaccaggggcttcaagcgtcgttgtaagctca
gtagcgagtcaaggtgcagcagtggcagtcccagcggccaatcagccagtgacatcggta
gcaagtgcagcagcgcctgttctaacacaagcatcaggcccttcgcatgcatcaccagcg
cttcgtcgttttgcgaatgagttaggtgttgatttagcaaaagtgatcggaacaggtcgt
aaaaatcgcattttgcatgaagatgtgacgaaatgggtgaaaaatacattatcgcgtcca
gcagcgacagcgagtgcaggaggaggtactgggttagatttattgccggtgccaaaagtt
gattttgctaaatttggtgcgattgaagagcagccactatcacggattaagaaaatctcc
ggggcgaatttacatcgcaattgggtgatggtgccgcatgtcacgcagtttgatgaagcg
gatatcaccgagatggaagcatttcgtaaagagcaaaataaattagctgaaaagaaaaaa
gctgattataaatttactccgttggctttcttgctcaaagctagcgctgcggcattaaag
gcgtttcctgagttctgtgcgtcactaaatgaagtcgctgatgcgttagtattgaaaaag
tacgtgcatatcggtgttgctgttgatacgccgaatggtttagtggtgccagtggtgcag
aacgttgatcaaaaaggtctcgttgagttatcacgtgaattaggtgagatcagtaaaaaa
gcgcgtgctggtaagctgacggcggtagatatgcaaggcggttgttttactatttcaagc
ttaggtggtttgggtggtacggcatttacacccattgtgaacttaccggaagttgcgatt
ttgggtgtatctaaatccagtatcaagccgatttggaatggcaatgattttgcgccacgg
ttaatgttgccattatcgctgtcttatgatcatcgtgtcattgatggagcggcggctgca
cgttttacaaccttcctagcagagcaattgtctgatctgcgtaatatgttgttgtag

DBGET integrated database retrieval system