KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0644Help
Entry
Psyr_0644         CDS       T00246                                 

Gene name
fabG
Definition
(RefSeq) 3-ketoacyl-ACP reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00061  Fatty acid biosynthesis
psb00780  Biotin metabolism
psb01100  Metabolic pathways
psb01130  Biosynthesis of antibiotics
psb01212  Fatty acid metabolism
Module
psb_M00083  Fatty acid biosynthesis, elongation
psb_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Psyr_0644 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Psyr_0644 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Psyr_0644 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psb01004]
    Psyr_0644 (fabG)
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Psyr_0644 (fabG)
Lipid biosynthesis proteins [BR:psb01004]
 Fatty acid synthase
  Component type
   Psyr_0644 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-GeneID: 3366122
NCBI-ProteinID: YP_233752
UniProt: Q4ZYQ8
LinkDB All DBs
Position
complement(731340..732695)
Genome map
AA seq 451 aa AA seqDB search
MPSDRYIDFANSDMGRRLVKAVGLPAPTHLERWQAGRLRPVEGTLLISAGPLGDQVRQFA
SRLTDSLYSFGSDMPGATTWVSNQGPRLKAVVFDASQILRTDQLRQLRDFFQPLLRNLDH
CAHVVILGKAPETLTDPLAASTQQAIEGFSRSLAKEVRNGATVKLLQVDDDAQDQLEGAL
RFFLTPKAAFISGQFVHLSACPSKVQDWTRPLAGLKAVVTGAARGIGASIAETLTRDGAQ
VILLDVPQTKNELEALASRLGGQALALDICAADAPAQLLEHLPDGVDILVHNAGITRDKT
LVNMPEDFWDSVLAVNLSAPQVLTQVLLDAGALKDNARIVLMASISGIAGNRGQTNYTTS
KAGLIGFARAMAPGLKSRGISINAVAPGFIETKMTAHMPFTLREAGRRMSSLGQGGSPQD
VAEAVAWFSQPGSGAVSGQVLRVCGQNVIGA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcagatcgctatattgatttcgccaactccgacatgggtcggcgcctggtgaag
gccgtcggtctgcccgcccccactcacctggagcgctggcaggccggacgtctgcgcccc
gtcgaagggaccttgctgatcagcgcaggaccgctgggcgatcaggtccgccagttcgcc
agccgtctgaccgactcgctgtacagcttcggcagcgacatgcccggcgccacgacgtgg
gtgtccaaccagggtccgcgccttaaggcagtggttttcgacgccagccagatcctgcgc
accgatcagctcaggcagttgcgggacttctttcagccgctgctgcgcaatctcgatcac
tgcgcgcatgtggtcattctcggcaaggcacccgagacactcactgatccgctggcggcc
agcactcaacaggccatcgaaggcttcagccgctcgctggccaaggaagtgcgcaatggc
gcaacggtcaagttgctgcaggtggatgacgacgcgcaggatcaactggagggcgccctg
cgcttcttcctcacgcccaaggctgcgttcatctccggccagttcgtccacctcagtgcc
tgcccgagcaaggtgcaggactggacccgcccgctggccgggctcaaggcagtagtgacg
ggcgctgcacgcggcataggcgcgtcaatcgccgaaaccctgacccgtgatggcgcgcag
gtcattctgctggatgtaccgcagaccaagaacgagctggaagcactcgcctcacggctt
ggcggtcaggccctggcgctggatatctgcgcggcggatgccccggcgcagttgctcgaa
cacctgcccgacggcgtcgacatactggtgcacaacgccggcatcacgcgcgacaagacg
ctggtcaacatgccggaagatttctgggactcggtactggcggtcaacctcagtgcgccg
caagtgctgactcaagtactgctcgacgcgggagccttgaaggataacgcgcggatcgtg
ctcatggcctcgatcagcggtatcgccggtaaccgcgggcaaaccaactacaccaccagc
aaggcaggtctgatcggttttgcacgggccatggcccccgggctcaagtcacgcggcatc
agcatcaacgccgtcgcgccgggcttcatcgaaacgaaaatgaccgcgcacatgccgttc
accctgcgtgaagccgggcggcgcatgagttcgctgggtcagggcggctcgccacaggac
gttgccgaagcggtggcgtggttcagccagccgggcagcggcgcggtgagcggtcaggtt
ctacgtgtatgtggtcaaaacgtgatcggggcttaa

DBGET integrated database retrieval system