KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1154Help
Entry
Psyr_1154         CDS       T00246                                 

Definition
(RefSeq) copper/Zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Psyr_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 3366648
NCBI-ProteinID: YP_234246
UniProt: Q4ZXB4
LinkDB All DBs
Position
1305713..1306231
Genome map
AA seq 172 aa AA seqDB search
MKPHLLLGLLGVFSFGVQAASLDVPINLVSADGAPKPVGSVTVSETQYGLLFTPNLKELP
AGIHGFHVHENGSCEAGTKDGKKVAALAAGGHFDPAKTGKHLGPYADGHLGDLPALYVAA
DGTASYPVLAPRLKKLSEIKGHALMVHAGGDNHSDHPAPLGGGGDRAACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcaccttttgctgggtctgcttggcgttttctctttcggtgttcaggctgca
tcgctggacgttccgatcaatctggtcagcgctgacggcgcccccaaacctgtcggcagc
gttacggtaagcgaaacccaatacggcttgctgttcactccgaatctgaaagagctgcct
gcgggcatccacggttttcatgtgcatgaaaacggcagttgcgaagcgggtaccaaggac
ggcaagaaggtcgcagccctcgcggctggcgggcacttcgacccggccaagaccggcaag
catctggggccttacgccgatggccatttaggcgatctgcctgcgctgtacgtggctgct
gacggcaccgcgagttatccggtgcttgccccacgcctgaagaagctctcggaaatcaaa
ggccatgcgctgatggttcacgccggcggcgacaaccattccgaccaccccgcaccccta
ggcggtggtggtgatcgtgctgcctgcggcgtgatctga

DBGET integrated database retrieval system