KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2369Help
Entry
Psyr_2369         CDS       T00246                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00010  Glycolysis / Gluconeogenesis
psb00052  Galactose metabolism
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
psb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyr_2369
   00052 Galactose metabolism
    Psyr_2369
Enzymes [BR:psb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Psyr_2369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 3367884
NCBI-ProteinID: YP_235446
UniProt: Q4ZTW4
LinkDB All DBs
Position
complement(2746798..2747946)
Genome map
AA seq 382 aa AA seqDB search
MKKHALLSTLGLSLMISTLTAQAAALSSEHSAFGQLPDGSAVEKYTLRNSHGVQASIITY
GATLQSLLVPDKAGKVEDIVLGFDDVQGYQNNGTVYFGATIGRFGNRLAGGKFSLDGKTY
QVPLNDKTNALHGGTQGFDKRLWKAEETKSGDSVGVKLTYLSPDGEMGFPGALLTEVTYS
LNEKNELKIDYRATTDKPTVLNLTNHSYFNLAGAGSGDVLKQVATLHASHYTPVNDKLIP
TGELPAVAGTPMDFLKPTAFGKHIKADHQQLKYAEPKQGGFDFNWVLDTKGDVKKLAAEV
SDPQSGRRLQLFTTEPGVQLYTGNFLDGSIHGKAGKVYPHWGAFTLETQHYPDAPNQPKF
PSTRLDPGKAYTQTTVFKFLND
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacatgcgcttctcagcacccttggactgtccttgatgatcagcaccctgacc
gcacaggccgccgcactctccagcgaacacagcgcgttcggccaactgcccgacggctct
gccgtcgaaaaatacaccctgcgcaacagtcacggcgtgcaggccagcatcatcacctac
ggcgcgacgctgcaatcgctgctggtacctgacaaggccggcaaggtcgaagacatcgtc
ctgggtttcgacgatgtgcagggctaccagaacaacggtacggtctatttcggcgcgacc
atcggccgcttcggcaaccggctggcaggcggcaaattcagtctggatggcaaaacctat
caggtcccgctcaatgacaagaccaacgcgctgcacggcggcacgcagggttttgacaag
cgtctgtggaaggcagaagaaaccaagagcggtgattcggtcggcgtgaagctgacctac
ctgtcgccggacggcgagatgggctttccgggtgccctgctgactgaagtgacctatagc
ctgaatgaaaaaaacgagctgaagatcgactaccgcgccaccaccgacaaaccgacggtg
ctgaacctgaccaaccacagctatttcaacctggccggcgctggcagtggtgatgtgctc
aaacaggtcgccacccttcacgcctcgcactacaccccggtcaacgacaagctgatcccg
accggtgaactgcctgctgtggctggcacgcccatggactttctcaagcccaccgcgttc
ggcaaacacatcaaggctgatcaccagcagttgaaatacgccgaacccaagcaaggcggg
tttgatttcaactgggtgctcgacaccaagggtgatgtgaagaaactggccgccgaggtc
agcgatccgcaatcaggccgcagactgcaactgttcaccacagagcccggcgtgcagctg
tacaccggtaacttcctggatggcagcattcacggcaaggcaggcaaggtctacccgcac
tggggcgcctttaccctggaaacgcagcactaccccgatgcacccaaccagccgaaattc
cccagcacccgactggatcctggcaaggcctacacccagacgactgtgttcaaattcctc
aacgactaa

DBGET integrated database retrieval system