KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2490Help
Entry
Psyr_2490         CDS       T00246                                 

Definition
(RefSeq) Alpha amylase, catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00500  Starch and sucrose metabolism
psb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Psyr_2490
Enzymes [BR:psb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Psyr_2490
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Psyr_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap KASH_CCD hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 3368007
NCBI-ProteinID: YP_235567
UniProt: Q4ZTJ3
LinkDB All DBs
Position
2894342..2897668
Genome map
AA seq 1108 aa AA seqDB search
MAKKPGDATFIKDPLWYKDAVIYQVHVKSFFDSNNDGIGDFAGLIEKLDYIAALGVNTIW
LLPFYPSPRRDDGYDISEYRDVHSDYGTMADAKRFIAQAHKRGLRVISELVINHTSDQHP
WFQKARNAKPGSKARDFYVWSDTDQKYDGTRIIFLDTETSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPHVLDAVLEVMRFWLDLGIDGLRLDAIPYLIERDGTNNENLPETHQVLKRIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDSKGPDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPENCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRRRL
APLVDRDRRRVELLNSMLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPMYGFQSVNVEIQERDPHSLLNWNRRMLAVRKQQKAFGRGTLKM
LSPSNRRILAYTREYTAPDGHSEVVLCVANVSSAAQAAELELSAYAGTVPVEMLGGSAFP
PIGQLSYLLTLPPYGFYWFLLASENQMPSWHVEPAQSMPDFPTLVLKKRLEELLEEPLRS
TMENTSLAVYLPKRRWFAGKDKAIEKVSIAYAVRFGEEANPVLLSEIEVTAGGQTDRYQL
PFGLLAEDDISSALPQQLALARVRRNRDVGLITDAFTLETFIRAVIQGMQSDTVIPCADG
ELRFEQSSQLAPLGLNAESEVRYLSAEQSNSSVVVGSSLVLKLIRKVSAGTHPELEMGAF
LTRAGFKNISPLLGSLVRVGKDGQPNLLMIAQGYLSNQGDAWEWTQNNLERAVRDELAHG
VSGQEQHYNALLELADFSRSLGQRLGEMHQILASPTDNADFAVEVTSSQDSKASGVSVNA
QLERALQLLEQRIGELDKDDQQLVNDLLAQRKQIRQRVEGLAKRSAGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARALEERRAKHSPFKDVSGVLRSFDYAAAMAVRSAQSVDTSP
EAAGARKRVADTYLAQARETFIEGYRSATTGIAHAWKDAKGEDAALELFTLEKAAYEVIY
EAENRPAWLAVPLQGLRGLLQPSDGESI
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaagcccggtgacgcgacatttatcaaagacccgctctggtacaaggatgcg
gtgatttatcaggttcacgtgaaatcgttctttgattccaataacgacggaatcggcgat
ttcgcgggcttgatcgaaaagctcgactacattgccgcgctgggcgtcaacaccatctgg
ttgttgccgttttatccgtcgccacgccgggacgatggctacgacatttccgaataccgg
gatgtgcacagcgactacggcaccatggccgatgccaagcgtttcatcgcccaggcacac
aagcgcggcctgcgagtgatcagcgagctggtcatcaatcatacttccgaccagcatccc
tggttccagaaagcccgcaatgccaagcccggttccaaggcgcgggacttctatgtgtgg
tcggacaccgatcagaagtacgacggtacgcggatcatctttctcgataccgagacgtcc
aactggacctgggacccggttgccggccagtacttctggcaccgtttctactcgcaccag
ccggatctgaatttcgacaacccgcacgtgctggatgcggttctggaagtcatgcgcttc
tggctggatctgggcatcgacggtttgcgtctggatgccattccgtatctcatcgagcgg
gacggcaccaacaacgagaacctgccggaaactcatcaggtgctcaagcgcatccgtgcc
gagatcgacgcgaactatccggaccgcatgctgctggccgaggccaaccaatggccggaa
gatacccagctgtattttggtgacagcaaaggcccggacggcgatgaatgccacatggcc
tttcactttccgttgatgccacgcatgtacatggcgctggcccaggaagatcgttttccg
atcaccgatattttgcggcagacgccggagatcccggaaaattgccaatgggcgattttc
ctgcgcaaccacgatgaactgaccctggaaatggtcaccgatcgtgagcgtgattacctg
tggaattactacgcggccgaccgccgtgcacggatcaacctgggcatccgtcggcgcctg
gcacccttggtggatcgcgatcgtcgccgggtcgagttgctgaacagcatgctgttgtcg
atgcccggcacaccgacgctgtattacggcgacgagatcggcatgggcgataacatctac
ctgggcgaccgggacggtgtgcgcacaccgatgcaatggtccatcgaccgcaacggcggt
ttttcgcgcgccgacccggccagcctggtgttgccaccgatcatggacccgatgtacggc
ttccagtcggtcaacgtcgaaatccaggagcgtgacccgcattcgctgctgaactggaac
cggcgcatgctcgccgtgcgcaaacagcagaaggcattcggacgtggcacgctgaaaatg
ctctcgccgtcgaaccgccgcattctggcgtatacccgcgaatacacagcacctgacgga
cacagtgaagtggtgctgtgtgtcgccaacgtttccagcgccgctcaggctgcagagctt
gagttgtctgcctacgcaggcacggtaccggtggaaatgctcggcggcagcgcattcccg
cccatcggccagttgagctacctgctgacgctgccgccgtacggcttttactggttttta
ctggcttcggagaatcaaatgcccagttggcacgttgaacccgcgcagagcatgccggac
ttcccgactctggtgctcaagaagcgtctggaagagttgctcgaagagccactgcgcagc
accatggaaaacacctcgctggcggtttacctgcccaaacggcgctggttcgcgggcaag
gacaaggcgatcgagaaggtcagcattgcctacgccgtgcgcttcggcgaagaagcgaat
ccggtgctgctcagcgaaatagaagtcaccgcaggcgggcagaccgatcgctatcaattg
ccgttcggcttgctggccgaagacgacatcagcagtgcactgccgcagcaactggcgctc
gcccgagtgcgtcgcaatcgcgatgtcgggctgatcacggatgcatttaccctggaaact
ttcatccgcgcagtgattcagggcatgcagtcggatacggtcataccctgtgccgacggc
gagttgcgtttcgagcaaagttcgcagctggcacccctcggcctgaacgccgagtcggaa
gtgcgctacctgtctgccgagcaatcgaacagttcggtggtggtcggcagcagcctggtg
ctcaagctgattcgcaaagtcagcgccgggacgcaccccgagctggaaatgggcgcgttc
ctgacccgtgccggcttcaagaacatttcgccgctgctgggctctctggtacgcgtcggc
aaggacggtcagcccaacctgctgatgatcgctcagggctatctgagcaaccagggcgat
gcgtgggagtggacccagaacaatctcgagcgtgcggtacgtgacgagctggcacatggt
gtttccggtcaggaacagcattacaacgcgctgctcgagctcgcggacttctcgcgcagt
cttggccagcgtctgggtgagatgcaccagattctcgcgtcgcccaccgacaatgcggat
tttgccgtcgaagtcaccagcagccaggacagcaaggcctccggggtcagcgtcaacgct
cagctcgagcgcgccttgcagctgctggaacagcgcatcggcgagctggacaaggacgat
cagcaactggtcaacgatctgctcgcgcagcgcaagcagatccgccagcgcgtcgaaggc
ctggccaagcgctccgccggtggcctgcgcattcgtgtgcatggcgatctgcatctgggg
caagtactggtggtcaagggtgatgcctacctgatcgatttcgagggtgaaccggcccgc
gcacttgaagagcgccgtgccaagcacagcccgttcaaggatgtcagcggtgtcctgcgg
tcctttgactacgctgcggccatggctgtacgcagtgcgcagagcgtcgacacgtctccc
gaggcagccggcgcgcgcaaacgtgttgccgatacctacctggcgcaggcgcgagaaacc
tttatcgagggttatcgctcggcgaccaccggcattgcccatgcctggaaagatgcaaaa
ggggaggacgctgcactcgagctgttcacccttgaaaaagctgcttatgaagtgatctac
gaagccgagaaccgtccagcctggctggccgttcccttgcaaggcttgcgtgggttgctg
caaccgtctgatggagagtcaatatga

DBGET integrated database retrieval system