KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2510Help
Entry
Psyr_2510         CDS       T00246                                 

Definition
(RefSeq) carbohydrate kinase PfkB
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00030  Pentose phosphate pathway
psb01100  Metabolic pathways
psb01120  Microbial metabolism in diverse environments
psb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psyr_2510
Enzymes [BR:psb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     Psyr_2510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 3368027
NCBI-ProteinID: YP_235587
UniProt: Q4ZTH3
LinkDB All DBs
Position
2918589..2919512
Genome map
AA seq 307 aa AA seqDB search
MSLPRVALIGECMIELQQHADGSLRQSFGGDTLNTAVYLSRLLGERAKVDYVTALGDDSF
SDAMCRIWADEGIGLGKVQRLPGRLPGLYCIQTDANGERRFLYWRNEAAVRDCFMTPAAE
PILAALASYDVLYFSGITLAVLGEQGRAKLLEALARARQRGVRVAFDNNYRPRLWASVEQ
AREAYLACLQHVDLALLTEDDEQALYGYADSEQLLAAYRGRGIGEIVVKRGAQSCLVEAG
GERFDIAAQKVERVVDTTAAGDSFSAGYLAARLTGQHPLQAAEAGHRLASIVIQHPGALV
PKSVMPV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagccttccacgggtcgccctgatcggcgaatgcatgatcgaactgcaacagcatgct
gatggcagcctgcgccagagcttcggcggcgacacgctcaataccgcggtctacctttcc
cgattgctgggtgagcgggccaaggtcgactacgtcactgcgctgggcgacgacagcttc
agcgatgcgatgtgccggatctgggcggacgagggcatcggtctgggcaaggtgcagcgc
ctgcctggacgcttgccggggctctactgcatccagaccgacgccaacggtgagcggcgt
ttcctctactggcgcaacgaagctgccgtgcgcgactgcttcatgaccccggcggccgag
ccgatcctggcagcgctggccagctatgacgtgctgtatttcagtggcatcaccctggca
gtgcttggcgagcaggggcgtgccaaactgctggaggcattggcgcgtgcgcgtcagcgc
ggagtcagggtcgccttcgacaacaactatcgtccgcggctgtgggccagtgtcgagcag
gcccgcgaagcctaccttgcgtgtctgcagcatgtagacctggccttgctgaccgaagac
gacgagcaggcactgtatggctatgccgacagcgaacaactgctggccgcctatcgcggg
cgcggcatcggtgaaatcgtcgtcaagcgtggcgcccagagttgcctcgtcgaagccggc
ggcgaacgtttcgacatcgcagcgcagaaggtcgagcgtgtggtcgataccacggctgcg
ggtgactcgttcagtgctggttatctcgcggcccggctcacgggtcaacacccgctgcag
gcagcggaagcagggcatcgcctggccagtatcgtgatccagcatccaggcgcgctggta
ccgaagtcggtcatgccagtctga

DBGET integrated database retrieval system