KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2567Help
Entry
Psyr_2567         CDS       T00246                                 

Definition
(RefSeq) zinc-containing alcohol dehydrogenase superfamily protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
KEGG Orthology (KO) [BR:psb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Psyr_2567
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Psyr_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 3368084
NCBI-ProteinID: YP_235644
UniProt: Q4ZTB6
LinkDB All DBs
Position
complement(2980696..2981811)
Genome map
AA seq 371 aa AA seqDB search
MSTVTERTAEQLSPVIPKTMQAVVCHGPEDYRLETVDVPTPGPDEILTKVELCGICMGDI
KTYRGAPSFWGDAEQPRYVKPPMIPGHEFVCRVVALGPGAEKRGVQIGDRVISEQIVPCW
GCRFCNHGQYWMCQKHDLYGFQNNVQGAMAQYMIFTREGIIHKVPDSIAPDEAILIEPLA
CSLHAAERADVDFDDIVVVAGAGTLGLGIIGAVRMRNPKKLIVLDMKPERAALALRMGAD
EVWNPAEVDVLAKIREITDGYGCDIYIEATGHHKAVNQGLAMLRKLGRFVEFSVFNDEAT
VDWSIIGDRKELDVLGSHLGPYMYPRAIDFIGNRKIDMRDVVTHKFPLAQFKEAFAVMER
GDKSLKVVLEP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcaccgaacgcactgccgaacaactttcaccggtcatcccgaaaaccatg
caggccgtggtctgccacggtccggaagactaccggctggaaaccgtggatgtgccgact
cccggccccgacgaaatcctcaccaaggtcgagctgtgtggcatctgcatgggcgacatc
aagacctatcgcggcgcgccctcgttctggggcgatgccgagcagcctcgctacgtcaaa
ccaccgatgattcccggccatgaattcgtctgtcgcgtggtggcgctcggccctggcgcc
gaaaagcgtggcgtgcagatcggcgaccgggtgatctccgagcagatcgtgccgtgctgg
ggctgccgcttctgtaaccacggacagtactggatgtgccagaagcacgacctttacggc
tttcagaacaacgtgcagggcgccatggcccagtacatgatttttaccagggaaggcatc
attcacaaggtgcccgactcgattgccccggacgaagccatcctcatcgaaccactggcc
tgctcgctgcacgcagccgaacgggccgacgtcgatttcgacgacattgtggtcgtcgcc
ggtgccggcacactgggccttgggatcattggcgcggtgcgcatgcgtaacccgaaaaaa
ctcatcgttctcgacatgaagcccgagcgcgccgccctcgccctgcgcatgggcgccgat
gaggtgtggaacccggccgaggtcgacgtgctggcgaagatccgcgagataaccgacggc
tacggttgcgacatctatatagaagccaccggacaccacaaggcggtcaaccaaggcctg
gcgatgctgcgcaaactcggacgctttgtggagttcagcgtattcaacgatgaggccacg
gtggactggtcgatcatcggtgaccgcaaggagctggacgtgctcggttctcacctcggc
ccttacatgtacccgcgcgccatcgactttatcggcaaccgcaagatcgacatgcgcgac
gtcgtcacgcacaaatttcccctggcgcagttcaaggaggcgtttgccgtcatggaacgc
ggtgataaatcattgaaggtggttctggaaccctga

DBGET integrated database retrieval system