KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3736Help
Entry
Psyr_3736         CDS       T00246                                 

Definition
(RefSeq) peptidoglycan-binding LysM
Organism
psb  Pseudomonas syringae pv. syringae B728a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_19 TPR_14 LysM ATG16 HTH_29 DUF641 TPR_21 TPR_4 Spc24 Atg14 FAM76 Cytochrom_B562 GAS
Motif
Other DBs
NCBI-GeneID: 3369271
NCBI-ProteinID: YP_236805
UniProt: Q4ZQ05
LinkDB All DBs
Position
complement(4449181..4451394)
Genome map
AA seq 737 aa AA seqDB search
MLKSLLAAVEGAGRKAREAFGKGVLAVSLLTCSTLASALGLGEITLHSALNQPLDAEIQL
LETGGLSNEDVVARLASPEAFAKAGMERVFFLNDLRFTPVLRGDRGVIRVVSSKPVTEPY
LSFLVQLARPNGDLLHEYTLLLDPATSAQGLAATRSRNQQRSASSASESRMPVAPPAAVQ
GKHYTVASGDTLNGIASRLQGPGNKVSASQLADGIRSLNPQVFAAGAGSALKVGQDLLLP
DAAVLPTAAAPAASAAAPSPKPAELQRTAEQLSAAAIENQQLTQSLEALKAQTQELQEQM
SGKDKQIIALRSDLATAQSAATPVAPATTTPAPATPVAAPAAPAQPVAASGSDSFLSLPI
LLAAVLIVLLLVAFAYSKRRQQRKESAAPGVTPDDPLIKPAQAAMLPVFEVPAVAPQPVV
QSPTTPAPAKPSPAQRSAGSAPDALDGVSIYIAYGRFTEAMGILRSALETQPERDDIRIR
LLELLAEQGDGSGFVREEQAALEHGVDPQTIQDIRDRFPQLKAAEVAPLAAIVPAAALAA
SALSFEKSEPEPSRYLQPEPEPEPAAQLDESAAAALNPQPADEFQLNLDDLSMDADWDLV
DPFDSPPPRAKPAAAPAPVEVDPGFSSDLTQLPEVFELSDEQFLSDFSEPEVVEPVEVIV
PSAADGLSDDFLDSFMNDDADFDLLDLEEPPLSQINQAQVLIEDGDLESAREILQQIIDE
SDEEHQRMARELLASIS
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagagtttactggctgctgtcgaaggtgcaggccgcaaggcgcgcgaggcgttt
ggcaagggcgtgttggcggtttcgttgctgacctgctccacgctggcgtcggcgttgggc
ctgggtgaaatcaccttgcattcggcgctcaaccagccgttggatgccgagattcagctg
ctggaaaccggcggtctgagcaatgaagacgtggtcgcccggcttgcttcgcccgaagcg
ttcgccaaagcaggcatggaacgcgtgttctttctcaatgatttgcgcttcacgccggta
ctgcgcggtgaccgcggcgtgatccgggtggtgtccagcaagccggtcaccgaaccctac
ctgagttttctcgttcagctggcgcggccgaatggcgatttgctgcacgaatacaccttg
ctgctcgatcctgccacctcggcgcaaggcctggccgccacgcgcagccgcaaccagcag
cgctcggccagctccgcctcggaaagccgcatgccggtcgcgccaccggcggccgtgcag
ggcaaacactatacggtggccagtggcgacacgctgaatggtatcgccagccgcttgcag
ggaccgggcaacaaggtgtcggccagccagctggcggacggcatccgttcgctcaacccg
caggtcttcgccgcaggcgccggctctgcgctcaaagtcggccaggacctgttgctgccg
gacgccgcagtgctgccaaccgccgcagcgcctgccgcaagcgctgcggcgccgtcgcca
aagcctgccgaactgcagcgcaccgctgagcagttgtcggctgctgccatcgaaaaccag
caattgactcagtcgctggaggcgctcaaggcccagactcaggaactgcaagagcagatg
agcggcaaggacaaacagatcattgctttgcgcagcgatctggccacggcgcaatccgcc
gctacgccagttgcacctgcaacaaccacacctgcacccgccacgccggtagctgcgcct
gccgctcctgcgcaacctgttgctgcgtcgggcagcgattccttcctgagcctgccgata
ctgctcgctgccgtattgatcgtactgctgctggtggcgtttgcttattcgaagcgacgt
cagcagcgcaaggaatcagcggcacccggagtcactccggatgacccgctgatcaagccc
gctcaggccgccatgctgccggtgttcgaagtgcctgccgtggcgccgcaacccgtggtg
cagagcccgacgacaccggcaccggccaaaccttcgccagcacaacgttccgctggctct
gccccggatgcgctggacggtgtgagcatttacatcgcctacgggcggttcaccgaggca
atgggtattctgcgcagcgccctggaaacccagcctgagcgtgatgacattcgcatccgc
ctgctggagttgctcgctgaacagggcgacggcagcggtttcgttcgcgaagaacaggcc
gcgctggagcatggcgtcgatccgcagaccattcaggacatccgcgatcgcttcccgcaa
ctcaaggctgccgaggtcgctcccttggcggcaatcgtcccggctgccgcgctggcagcc
agcgcactgtcgttcgagaaatccgagcccgagccttcgcgctacctgcagcccgagcct
gagccagaacccgccgcgcagctggatgaaagcgccgctgcggcgctgaatccgcagccc
gccgacgagtttcagttgaacctggatgacctgtcgatggacgccgattgggacctggtc
gacccgttcgacagcccaccgccgcgtgccaagcctgccgctgcgccagcccccgttgaa
gtcgatcccggtttttcttcggacctgacccaactgccggaagtcttcgaactctcggac
gaacagttcctcagtgatttctccgagcctgaggtcgttgagcctgttgaggtaatcgtg
ccatccgccgccgacggtctgagtgacgatttcctcgacagtttcatgaacgatgacgcc
gatttcgacctgctggacctggaagagccgccgctcagccagatcaatcaggcgcaggtg
ctgatcgaggacggcgatctcgaatcggcccgtgaaatcctccagcagatcattgacgag
tccgacgaagagcatcagcgcatggcgcgggagctgctggccagcatcagctga

DBGET integrated database retrieval system