KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3904Help
Entry
Psyr_3904         CDS       T00246                                 

Definition
(RefSeq) major intrinsic protein
  KO
K02440  glycerol uptake facilitator protein
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
KEGG Orthology (KO) [BR:psb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psb02000]
    Psyr_3904
Transporters [BR:psb02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    Psyr_3904
Ion channels [BR:psb04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   Psyr_3904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 3369439
NCBI-ProteinID: YP_236972
UniProt: Q4ZPI8
LinkDB All DBs
Position
4645020..4645877
Genome map
AA seq 285 aa AA seqDB search
MSIALKQPTLTGQCVAEFLGTALMIFFGTGCVAALKVAGATFGLWEISIIWGIAVSMGIY
LSAGISGAHLNPAVSIALSLFAGFEKRKLPFYISAQIAGAFCGAGLVYLLYISLFFDFEH
AHHIIRGSEQSLELASVFSTYPNPAISVGQAFLVEVVITTILMGVIMALGDDSNGLPRGP
LAPLLIGLLVAVIGSSMGPLTGFAMNPARDFGPKLMTFFAGWGEMAFTGGRDIPYFLVPI
FAPILGACLGAAGYRALIARHLPSAAPVENEKEAPVVRGKVQASS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgcactaaaacaaccgacgctcaccgggcaatgtgtggctgaatttcttggc
accgccctgatgatttttttcggcacaggatgcgttgcagcgctcaaggtagcgggagcc
accttcggcctttgggaaatcagcatcatctggggcattgccgtcagcatggggatctac
ctcagcgccggcatttcgggtgcccacctcaacccggccgtcagcatcgcgctgagtctg
ttcgccggttttgaaaaacgtaaattgcccttctatatctcggcgcaaatcgcaggcgcg
ttctgcggagcgggtctggtgtacctgctgtacatcagcctttttttcgacttcgaacat
gctcaccacatcattcgcggcagcgagcagagtcttgaactggcctcggtgttctcgacg
tatccgaacccggccatttcggtcggtcaggcctttctggtcgaagtggtcatcaccacc
attctgatgggtgtgatcatggccttgggcgatgacagcaatggtttgccacgcggcccg
ctggcacccttgctgatcggcctgctggtagccgtgatcggcagctcgatgggcccgctg
accggtttcgccatgaacccggcacgcgacttcggtccgaagctgatgaccttcttcgct
ggctggggtgaaatggccttcaccggtggtcgcgacattccttatttcctggttccgatt
tttgcgcccattctgggtgcctgccttggtgctgccggctaccgcgcgctgattgcgcgt
catctgccaagcgccgctcctgttgaaaatgaaaaagaggctcctgtggttcgcggcaaa
gttcaggcttcatcttga

DBGET integrated database retrieval system