KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4100Help
Entry
Psyr_4100         CDS       T00246                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00473  D-Alanine metabolism
psb00550  Peptidoglycan biosynthesis
psb01100  Metabolic pathways
psb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Psyr_4100 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Psyr_4100 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Psyr_4100 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psb01011]
    Psyr_4100 (ddl)
Enzymes [BR:psb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Psyr_4100 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:psb01011]
 Precursor biosynthesis
  Amino acid ligase
   Psyr_4100 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter TTL ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 3369636
NCBI-ProteinID: YP_237168
UniProt: Q4ZNZ2
LinkDB All DBs
Position
complement(4888521..4889480)
Genome map
AA seq 319 aa AA seqDB search
MTAVAQSSLRSTLEPKSFGRVAVLFGGKSAERAVSLNSGNAVLGALLEAGVDAFGIDVGD
DFLQRLVSEKIDRAFIVLHGRGGEDGTMQGLLECLEIPYTGSGVLASALAMDKLRTKQVW
QSLGLATPAHAVLENESDCICAATELGLPLIVKPAHEGSSIGMAKVNSVDELIAAWKAAS
TYDSQVLVEQWIQGPEFTVASLRGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLGD
AQEQELKQLAARACDAIGIAGWARTDVMQDAQGKFWLLEVNTVPGMTDHSLVPMAARAAG
LDFQQLVLAILADSVQARG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgttgcccagtcgtccctgcgctcgactctcgagccgaaaagcttcggccgt
gtcgccgtgctcttcggtggcaagagtgccgagcgtgcggtctcgctgaactcgggtaat
gccgtgctcggcgcgttgctcgaggctggtgtggatgcgttcggcatcgatgtgggcgat
gacttcctgcagcgactggtcagcgaaaaaatcgaccgtgcctttattgttctgcacgga
cgcggcggtgaagacggcaccatgcaaggcctgctggaatgcctggaaatcccttatacc
ggcagtggcgtactggcttctgcgctggcgatggacaagctgcgcaccaagcaggtctgg
cagagtctgggccttgctacaccggcgcatgccgttcttgaaaacgagagtgattgtatt
tgcgcggcgacggaactgggcttgcctttgatcgtcaaaccggcccatgaaggttcaagt
atcggtatggcaaaggtgaacagcgtcgatgaattgatcgccgcctggaaagccgccagt
acctacgattcgcaagtattagtcgaacaatggattcagggacctgagttcactgtggcg
tctctgcgtggccaggtgttgcctcccatcggcctgggcactcctcacagtttttatgat
tacgatgccaagtaccttgcgtccgatacccagtatcggattccgtgcggacttggcgat
gcgcaggaacaggaactcaaacaacttgcagcacgtgcttgcgatgccattggcattgca
gggtgggcgcgcacggatgtcatgcaggacgcacaaggcaagttctggttactggaagtc
aatactgtaccgggcatgaccgatcacagtctggtgcctatggcggcccgtgcggcaggt
ctggattttcaacaactggtgttggcgattctggccgacagcgttcaggcgaggggttaa

DBGET integrated database retrieval system