KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4361Help
Entry
Psyr_4361         CDS       T00246                                 

Definition
(RefSeq) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00550  Peptidoglycan biosynthesis
psb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Psyr_4361
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:psb01002]
    Psyr_4361
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psb01011]
    Psyr_4361
Enzymes [BR:psb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Psyr_4361
Peptidases [BR:psb01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Psyr_4361
Peptidoglycan biosynthesis and degradation proteins [BR:psb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Psyr_4361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 3369901
NCBI-ProteinID: YP_237429
UniProt: Q4ZN81
LinkDB All DBs
Position
complement(5213965..5215152)
Genome map
AA seq 395 aa AA seqDB search
MPIRILERRMNITTFAKRLCLLVPLIITPTVWAAEQMTPAAPQLAAKSYVLMDATSGNVL
VENNGDQRLAPASLTKLMTAYIATLEIRRGQIGENDPVTISENAWRTGGSRMFIKVGSQV
TVSDLLHGIIIQSGNDASVAISEHIAGSEDAFADMMNKTAGDLGMTNSHFMNPTGLPNPE
HYSSAHDMAILARAIIHEDPAHYAIYSQKEFFWNGIKQPNRNLLLWRDKTVDGLKTGHTD
EAGYCMVSSAVRDGMRLIAVVFGTNSEQARAAETQKLLTYGFRFFETQNFYQKGTELAQA
TVWKGTERQVKAGLAEDLSMTMPKGDMKKLSASMTMNPQLVAPIAKGDVIGKVEVKKDDQ
VVHTANLIALDGVEEGGIFRRVWDSIRLFFYGLFN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgcccattaggattctcgagagacggatgaacatcaccacctttgcaaaacgtttgtgc
ctgcttgttccactgattatcaccccgactgtgtgggcggcagagcagatgacgcctgct
gcaccgcaactggcggccaagtcctacgtgctgatggatgccaccagtggcaacgtcctg
gtcgagaacaatggtgatcagcgtctggctcctgccagcctgaccaagctgatgaccgcc
tacatcgcgaccctggaaatccgtcgcggccagatcggcgaaaacgatccggtgacgatc
agtgaaaacgcctggcgcacaggcggttcgcggatgttcatcaaggtcggcagccaggtc
acggtcagcgacctgttgcacggcatcatcatccagtcgggtaacgacgccagtgtcgcg
atctccgagcacatcgccggcagcgaagacgccttcgccgacatgatgaacaagactgcc
ggcgacctgggcatgaccaacagccacttcatgaacccgaccggtctgccgaaccctgag
cactactcgtcggctcacgacatggcgatcctggcacgcgcgatcattcacgaggacccg
gcccactatgcgatctactcgcagaaggagttcttctggaacggcatcaaacagcctaac
cgtaacctgctgctgtggcgcgacaagaccgttgacggtctgaaaaccggtcacaccgat
gaagccggctactgcatggtgtcctcggcagtacgtgacggcatgcgcctgatcgccgtg
gtgttcggcaccaacagcgaacaggcccgtgcggcggaaacccagaagctgctgacctat
ggcttccgtttcttcgaaacccagaacttctatcagaagggcaccgagctggcccaggcc
acggtctggaaaggcaccgagcgtcaggtcaaggccggtctggctgaagatctgagcatg
accatgccaaaaggcgacatgaagaagctgtctgccagcatgaccatgaacccgcaactg
gttgcgccaatcgccaagggcgacgtgatcggcaaggtcgaggtcaagaaagacgatcag
gtggttcacaccgccaatctgattgcgctcgatggggttgaggaaggtggtattttccgc
cgcgtgtgggatagcatccgcctgttcttctacggcttgttcaactga

DBGET integrated database retrieval system