KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4365Help
Entry
Psyr_4365         CDS       T00246                                 

Definition
(RefSeq) peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00550  Peptidoglycan biosynthesis
psb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Psyr_4365
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Psyr_4365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psb01011]
    Psyr_4365
Enzymes [BR:psb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Psyr_4365
Peptidoglycan biosynthesis and degradation proteins [BR:psb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Psyr_4365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-GeneID: 3369905
NCBI-ProteinID: YP_237433
UniProt: Q4ZN77
LinkDB All DBs
Position
complement(5218555..5220450)
Genome map
AA seq 631 aa AA seqDB search
MSQPIRLKDHEKDARLVRGRVVFGAVAVVLLVCVLIARLYYLQVIQYEYHSTLSENNRVH
VQPIPPSRGLIYDRNGVVVADNRPSFSLSMTRERAGEWSSVLDTIVEILQLTPDDRIIFE
KRMKQGRRPFEPVPILFELSEEQIALIAVNQFRLPGVEVVAQLVRHYPQGPHFAHSVGYM
GRINEKELKSLDPINYSGTHHIGKTGIERFYEPELHGQVGYEEVETNARGRVLRVLKRTD
PIPGKDIVLSLDIKLQEAAEAALGGRRGAVVALDPATGEVLAMVSAPSFDPNLFVTGISF
KAYAELRDSIDRPLFNRILRGLYPPGSTIKPAVAIAGLDTGAVTPGSRVFDPGYYQLPNY
DHKYRNWNRTGDGWVDLDTAIMRSNDTYFYDLAHKVGIDRLATYMNKFGIGQKVSLDMFE
ESPGLMPSREWKRATRRQAWFPGETLILGIGQGYMQATPLQLAQATALVANKGVWNRPHL
ARTIEGKAPVDENPMPDIVLRDPANWGRVNHGMQEVMHGARGTARKAAIGAQYRIAGKSG
TAQVVAIKQGEKYDRTKVQERHRDHALFVGFAPADNPKIVVAVMVENGESGSGVAAPVVR
QVLDAWLLDENGHLKPEYAGSLNLEAAAREE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaccgatccgcctcaaagaccacgaaaaggacgcacgcctggtgcgcggcagg
gtcgtgttcggtgctgtggcggtggtgttgctggtgtgcgtgctgattgcccggttgtat
tacctgcaggtcatccagtacgagtatcactccacgctttcggaaaataaccgcgttcac
gttcagccgattccgcccagccgcgggttgatctacgaccgtaacggcgttgtggtcgcc
gataaccggcccagtttcagtctcagcatgacccgtgagcgcgccggcgagtggtccagc
gtgctcgacaccattgtcgagatcctgcagctcacccccgacgaccgcatcatcttcgaa
aagcgcatgaagcaggggcgtcggccattcgagccggtgcccatcctgttcgagctgagc
gaggagcagatcgccctgatcgccgtcaaccagttccgcctgccgggcgtcgaagtggtt
gcgcaactggtcaggcattacccgcaagggccgcactttgcccactcggtcggctacatg
gggcgcatcaacgagaaagagctcaagagcctcgacccgatcaattacagcggcacgcac
catatcggcaagaccggcatcgagcgcttttacgagcccgagctgcatggtcaggtcggc
tacgaagaggtcgagaccaacgcccgtggtcgcgtattgcgtgtgctcaagcgcaccgac
ccgatccccggcaaggacatcgtcctgagcctggacatcaagcttcaggaagccgccgaa
gcggcactgggcgggcgtcgtggtgcggtcgtcgcactggacccggccaccggggaagtg
ctggcgatggtcagtgcgccgagcttcgatccgaatctgtttgtcaccggcatcagcttc
aaggcctatgccgagctgcgcgattccatcgaccggccgctgttcaaccgcatcctgcga
gggctgtacccgccgggctcgaccatcaagcccgcagtggcgattgccgggctggatacc
ggtgcggtgacgcctggctcgcgggtattcgatccgggctattaccaactgcccaattac
gatcacaagtaccgcaactggaaccgcaccggcgatggctgggtcgatctggatacggcg
atcatgcgttcaaatgacacgtacttctacgatctggcacacaaggtgggcattgatcga
ctcgctacctacatgaacaagttcggtatcgggcagaaggtctcgctggacatgttcgaa
gaatctcccggcctgatgccgtcccgtgagtggaagcgcgccacgcgccggcaagcctgg
ttccccggcgaaaccctgatcctcggcatcggtcagggctacatgcaggcgacgcctttg
caactggcccaggcgaccgcgctggtggccaacaagggtgtatggaatcggccgcatctg
gccagaaccatcgaaggcaaggcgcccgtggatgaaaatccgatgccggacatcgtgctg
cgcgacccggccaactggggacgcgtcaaccatggcatgcaggaagtgatgcacggcgcg
cgcggtacggcgcgcaaggccgccattggtgcgcagtaccggattgccggcaagagcggt
actgcccaggtggtggccatcaagcagggcgagaaatacgaccgcaccaaggtgcaggaa
cgccaccgcgaccacgccttgttcgtcggcttcgccccggctgataacccgaaaatcgtt
gttgcagtgatggtcgagaacggcgagtccggttccggcgttgctgcacccgtcgtgcgt
caggtcctggacgcctggctgctcgacgaaaacggccatctcaaacccgagtacgccggt
tccctgaatctggaggctgcggcccgtgaagagtaa

DBGET integrated database retrieval system