KEGG   Pseudomonas stutzeri CCUG 29243: A458_06255
Entry
A458_06255        CDS       T02168                                 

Definition
(GenBank) lytic transglycosylase catalytic subunit
Organism
psc  Pseudomonas stutzeri CCUG 29243
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: AFM32497
UniProt: I4CQZ0
LinkDB
Position
1376650..1377270
AA seq 206 aa
MAAAIGAPGRERRPSRIAIRCASAMLLLTTGGWALAALAREVPPPAYQLAAHRADVPAAV
LYAVALQESGAMLRGRLIPWPWTLNVAGSPQRYATRAEACAGLHRALAHTPANRIDAGLG
QVNLGYHAHRYTQPCELLDPYRNLAIAAEILREQHTPGEDWLLAIGRYHRPAGGAPAARY
RRSVHRHLTRVLDPDVPVPTLQATTP
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcagcggcaataggtgctccgggccgggagcgtcggccgtcccgcatcgccatccgc
tgcgccagcgccatgctgctgctcaccaccggcggctgggcattggccgccctggcgcgg
gaagtgccgccgccggcctatcaactggcggcgcaccgtgcagacgtgccggcggcggtg
ctgtacgcggtggccttgcaggagagcggcgccatgctgcgcgggcgcctgatcccctgg
ccgtggacgctcaacgtcgccggctcgccacagcgctatgccacccgcgccgaggcctgc
gcggggctgcaccgtgccctcgctcacacgccggccaatcgcatcgacgccggcctcggc
caggtcaatctcggctaccacgcgcatcgctacacgcagccctgcgagctgctggacccg
taccgcaacctcgccatcgctgcggaaatcctgcgcgaacagcacacgccgggcgaggac
tggctgcttgccatcggccgctaccaccggcccgccggcggggcacccgcggcgcgctac
cggcgcagtgtgcatcggcacctgacccgcgtgctcgaccccgacgttcccgttccaacc
ctccaggccaccacgccatga

DBGET integrated database retrieval system