KEGG   Pseudomonas stutzeri CCUG 29243: A458_06705
Entry
A458_06705        CDS       T02168                                 

Definition
(GenBank) 1,2-dihydroxynaphthalene dioxygenase
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00626  Naphthalene degradation
psc01100  Metabolic pathways
psc01120  Microbial metabolism in diverse environments
psc01220  Degradation of aromatic compounds
Module
psc_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    A458_06705
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.56  1,2-dihydroxynaphthalene dioxygenase
     A458_06705
SSDB
Motif
Pfam: Glyoxalase
Other DBs
NCBI-ProteinID: AFM32587
UniProt: I4CR80
LinkDB
Position
complement(1469980..1470888)
AA seq 302 aa
MSKQPAVIELGYMGISVKDPDAWKSFATNMLGLQVLDEGEKDRFYLRMDYWHHRIVVHHN
GQDDLEYLGWRVSGKPEFEALGQKLIDAGYDVRVCDKAEAQERMVLGLMKTVDPGGNPTE
IFWGPRIDMNNPFHPGRPLHGKFVTGDQGLGHCIVRQTDVEAAHKFYSLLGLRGDVEYRI
PLPNGMTGELTFMHCNGRDHSIGFGAMPAEKRLNHVMLEYTDIEDLGYTHQQFVKNDIDI
ALQLGIHANDKALTFYGATPSGWLIEPGWRGAKAIDEAEYYVGDIFGHGIETTGYGLDVK
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagtaagcaacctgcagttattgaactcggatacatgggcatctcggtcaaggatcct
gatgcgtggaaatcattcgccacgaatatgctgggcctgcaagttcttgatgaaggtgag
aaggaccgtttctatctacgtatggattactggcatcatcgaatcgtggtccatcataac
ggccaggacgacctggaatacctgggctggcgtgtgtccggaaaaccggagttcgaggct
ctcggtcaaaaactcattgacgccggttacgatgttcgcgtctgcgataaagccgaggct
caggaacgaatggtgttgggcctgatgaagacagtagatccaggcggcaacccgaccgag
atattctggggcccccggatcgacatgaacaacccgttccatcccggccgccccctgcac
ggcaagtttgtgactggtgaccaaggcctgggtcattgcatcgttcgccagaccgatgtc
gaagctgcccacaagttctatagtcttctgggcttgcgtggggacgtcgaataccggatc
ccgctgcccaacggcatgactggcgaactaacgttcatgcattgcaatggtcgggaccac
tccattgggtttggtgccatgcccgctgaaaagaggctcaatcatgtgatgcttgagtac
accgacatagaggatctgggatacacccatcaacagtttgtaaagaacgacattgacatt
gccttgcaacttggcattcatgctaacgacaaggcgctgacgttctatggcgcaacacct
tccggctggctcattgagcccggctggcgaggtgccaaggccatagacgaagcggagtac
tacgttggagacatctttggccatggtatcgagaccactggctacggcctggatgtaaaa
ttgagttaa

DBGET integrated database retrieval system