KEGG   Pseudomonas stutzeri CCUG 29243: A458_06710
Entry
A458_06710        CDS       T02168                                 

Definition
(GenBank) salicylaldehyde dehydrogenase NahF
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00626  Naphthalene degradation
psc01100  Metabolic pathways
psc01120  Microbial metabolism in diverse environments
psc01220  Degradation of aromatic compounds
Module
psc_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    A458_06710
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.65  salicylaldehyde dehydrogenase
     A458_06710
SSDB
Motif
Pfam: Aldedh OmdA
Other DBs
NCBI-ProteinID: AFM32588
UniProt: I4CR81
LinkDB
Position
complement(1470916..1472367)
AA seq 483 aa
MNTKLFINNVWVNSSDQQTFERKHPVSGEVMTECANSTVMDALKAAQAAQEAFQTWKTVG
PSERRRLLLRVAEVMESKTPEFIEVMAKEVGASALWAGFNVQMSANVFREAASLATQIQG
ETIPTDKSDTLSMTLRQPVGPILSIVPWNGTAVLAARAIAYPLVCGNAVVFKGSEFSPAT
HALITQCVQEAGLPAGVLNYLNSSPDRSPEIADALISAKEIRRINFTGSTRVGSIIAQKA
AQHLKRCLLELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEF
VAKFAEKAKRLSAGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGATVACGGMAQGAV
MPATILDHVKSNMRIYDEETFGPITVVIRCNGEAEAIRIANDSAYGLSSGVFGRDINRAL
RVGMSIEYGSVHINGSTVQSEAQAPYGGTKNTGYGRFDGRAVIDEFTELKWLTIEPFEQQ
YPF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaatacaaaattgtttatcaacaatgtctgggtcaattccagtgaccaacagaccttc
gagcgaaagcaccccgtcagtggtgaggtgatgacggagtgtgcaaactccacggtgatg
gatgcgttaaaggccgcgcaagctgcccaagaggctttccagacctggaagactgttgga
ccttcggagcgtcgccgccttctgctgagggtcgctgaggttatggaaagtaaaacaccc
gagtttatcgaagtgatggccaaggaggtgggagcctccgctctttgggccggcttcaat
gtccagatgtcagccaatgtgttccgtgaagcggcatcgctggctacacaaattcagggg
gaaactattccgacagacaagtctgacacgctctcaatgacgctacgtcagccggtcggt
ccgatcctgagcatcgtgccgtggaacggcaccgcagtgctggcggcacgagccatcgct
tatccgctggtctgcggcaacgcggtggtattcaaaggttctgagtttagtcccgcgacg
catgccctgatcacccagtgcgtgcaggaagccgggctgcctgctggcgtgctcaactat
ctcaactcttcgcctgaccgttcgcccgagatcgccgacgcactgatctcagccaaggag
atccgacgcatcaacttcacgggctccacccgcgtgggcagtattatcgcgcagaaggcc
gcgcaacacctcaagcgctgcctgctggagctcggtggcaagtccccacttattgttctg
gatgacgcggacatcgacgcagctgtcaaggcagcggtgttcggtagcttcctgttccaa
ggtcagatctgcatgtccactgagcgcttggtggttgatgagaagatcgccgacgaattt
gtcgccaagtttgccgaaaaggccaagcgtttgagcgcgggcgacccatgcgtaactggc
gactgcatcatcggcccaatggtctcgccaaattcaggcgagcggatcaatggtttgttc
aaggacgcgatcgacaaaggagccacagttgcctgcggcggcatggcccaaggtgcggtc
atgccggccacgatcctggatcacgtcaaatccaacatgcggatctacgatgaggagacc
ttcggtcccatcactgtggtgatccgttgcaacggcgaagcagaggccattcgcattgcc
aacgacagcgcctatggcctgtcgtcgggcgtatttggccgcgacatcaaccgtgctttg
cgcgtgggcatgtccatcgaatatggttcagtgcacattaacggatcgactgtccaaagc
gaggcgcaggctccatacggaggcactaagaacactggctacgggcgcttcgacggccgt
gctgtgatcgatgagttcacagagctcaagtggctgaccatcgagcctttcgagcagcag
tatcccttctaa

DBGET integrated database retrieval system