KEGG   Pseudomonas stutzeri CCUG 29243: A458_06715
Entry
A458_06715        CDS       T02168                                 

Definition
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00624  Polycyclic aromatic hydrocarbon degradation
psc00626  Naphthalene degradation
psc01100  Metabolic pathways
psc01120  Microbial metabolism in diverse environments
psc01220  Degradation of aromatic compounds
Module
psc_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    A458_06715
   00624 Polycyclic aromatic hydrocarbon degradation
    A458_06715
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     A458_06715
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     A458_06715
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase KR YjeF_N DUF608
Other DBs
NCBI-ProteinID: AFM32589
UniProt: I4CR82
LinkDB
Position
complement(1472415..1473194)
AA seq 259 aa
MSNQQVVSITGAGSGIGLALVRSFKSAGYCVSALVQNEEQKASLCNEFKDALEIVVGDVR
DHATNEKLIKQTTDRFGHLDCFIANAGIWDYMLGIEEPWEKISSSFDEIFNINVKSYFSG
IRAALQELKKTSGSVVMTASVSSHAVGAGGSCYIASKHAVLGMMKALAYELAPHIRVNAV
APGGTVTSLCGPASAGFDKTHMENMPGIEDMIKGLTPLGFAAKAEDVVAPYLLLASRDQG
KFITGTVINIDGGMALGRK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcaatcaacaagtcgtttcgataaccggtgctggctcaggaattggtctcgcactg
gttcgatcctttaagtccgccggttattgcgtatccgctctcgtacaaaacgaggagcaa
aaggcgagcctttgcaatgagttcaaggacgcactcgagatcgtcgtgggcgatgtccgg
gaccacgcaacaaatgagaagctgataaagcaaacaaccgatagattcggccatctcgat
tgtttcattgcaaatgccggtatttgggattacatgcttggcatcgaagagccttgggag
aaaatatcgagcagttttgatgagatattcaacatcaatgtcaagagctatttcagcggt
atcagggccgccctgcaggaactgaaaaagactagcggatcagtggtgatgaccgcttca
gtgtcgtcccatgcggtcggtgctggtggttcttgctacatcgccagcaagcatgcggtc
ctgggcatgatgaaagctttggcttacgaattggctccccacattcgcgtcaacgccgta
gcaccgggcggcactgtgacgtctctgtgcggtcccgcaagcgccggcttcgacaaaact
cacatggaaaacatgcccggtatcgaggacatgatcaagggtctaacgcctcttggattt
gcagccaaggccgaagacgtagtggcaccctatttgttgttggcgtcgcgagatcaaggg
aaattcattaccgggactgtcattaatatagatggagggatggcgctcggtcgcaagtag

DBGET integrated database retrieval system