KEGG   Pseudomonas stutzeri CCUG 29243: A458_08310Help
Entry
A458_08310        CDS       T02168                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00061  Fatty acid biosynthesis
psc00780  Biotin metabolism
psc01100  Metabolic pathways
psc01212  Fatty acid metabolism
Module
psc_M00083  Fatty acid biosynthesis, elongation
psc_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A458_08310 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A458_08310 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psc01004]
    A458_08310 (fabZ)
Enzymes [BR:psc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A458_08310 (fabZ)
Lipid biosynthesis proteins [BR:psc01004]
 Fatty acid synthase
  Component type
   A458_08310 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas AfsA
Motif
Other DBs
NCBI-ProteinID: AFM32908
UniProt: I4CS51
LinkDB All DBs
Position
1796394..1796834
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVTEMDVEAKRVRAYKNVTINEPFFNGHFPQHPIMPGVL
IIEAMAQAAGLLGFKMMGVKPADGTLYYFVGSDKLRFRQPVVPGDQLVLEASFISAKRGI
WKFDCRASVEGKPVCSAEIICAEQKI
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggatatcaacgagattcgtgaatatttgcctcaccgctacccgttcctgctggtg
gaccgtgtgacggagatggacgtcgaggccaagcgcgttcgtgcctacaagaacgtgacc
atcaacgaaccgttcttcaatgggcattttccacagcatccgatcatgccaggcgtgctg
atcatcgaagccatggcgcaggcggccggtctgcttggtttcaagatgatgggcgtcaag
ccagccgatggcacgctttactatttcgtcggctctgacaagctgcgcttccgtcagccg
gtggttccgggcgatcagttggtgctggaagcttccttcatcagcgccaaacgcggcatc
tggaagttcgattgtcgtgcgagcgtcgagggcaagccggtctgctcggcagaaatcatc
tgcgcggaacagaagatatga

DBGET integrated database retrieval system