KEGG   Pseudomonas stutzeri CCUG 29243: A458_09985Help
Entry
A458_09985        CDS       T02168                                 

Definition
(GenBank) alpha-amylase family protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00500  Starch and sucrose metabolism
psc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A458_09985
Enzymes [BR:psc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A458_09985
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     A458_09985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase EcKinase HTH_18
Motif
Other DBs
NCBI-ProteinID: AFM33236
UniProt: I4CT29
LinkDB All DBs
Position
2169767..2173093
Genome map
AA seq 1108 aa AA seqDB search
MAKPRKPAAFIKDPLWYKDAVVYQVHLKSFYDSNNDGVGDFPGLIEKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIADYRGVHPEYGSMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKKGSAARDFYVWSDTDKKYDGTRIIFLDTEKSNWTWDPVAKQYFWHRFYSHQ
PDLNFDNPQVMKAVLAVMRYWLDMGIDGLRLDAIPYLVERDGTNNENLPETHAVLKAIRA
EIDANYPDRMLLAEANQWPEDTQLYFGGEDGGPGDECHMAFHFPLMPRMYMAIAQEDRFP
ITDILRQTPDIPENCQWAIFLRNHDELTLEMVTDKERDYLWNYYASDKRARINLGIRRRL
APLLERDRRRIELLNSLLLSMPGTPVIYYGDEIGMGDNIFLGDRDGVRTPMQWSVDRNGG
FSRADPPNLVLPPVMDPLYGYYTINVEAQQRDPHSLLNWTRRMLTIRKQFKAFGRGTLKM
LAPSNRRILAYMREFTGANGETEIIFCVANVSRSAQAAELEMSQYAGMVPVEMVGGSAFP
PIGQLPYLLTLPHYGFYWFQLALTNQMPSWHQEPVDTMPDFQTLVLKRLDTLTAANRRIL
ETEALPAYLPKRRWFAAKDVAIESVRISYCVPFGDPNRPVLLSELCVESAGRSDLYQLPL
GFLAETEFEVALPQQLALARVRRGPQVGLMTDAFALEQFSAAVIQGLRDELVLPCNDGEI
RFVPMPQLADLQLPAHPEVRFISAEQSNSSAIIDNKVMIKLLRRVAPGVHPELEMGGFLT
ERGFAHISGMLGQVSRINKQGEPVALMVIQHFLDSQGDAWVWTLNNLDRAVRDEIAGGVS
MHENQFSALDELQAFNRLLGQRLGEMHMALATQTEDPAFAYESTSTADTKQWEQSVSAQL
EQALQRLEEHRSSFDRKEATALGQLLARRDKLLEQVQRLAARTVGGVRTRVHGDLHLGQV
LVVQGDAYFIDFEGEPARSLDERRAKHSPFKDVSGLLRSFEYAAAMTIRGAQISDSTPEA
DQARQRIAASYQSSAQAAFFEAYREATAELPHDWRDADGANAALLLFSLEKCAYEIVYEA
ENRPTWLPVPLQGLLALAQQLFDGGSND
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccgcgcaaacccgccgctttcatcaaggacccgctctggtacaaggacgcg
gtggtgtatcaggtgcacctgaagtccttctacgactcgaacaacgacggagtcggtgac
ttccccggcctgatcgagaagctggattacatcgccgaccttggggtgaacaccatctgg
ctgctgccgttctatccgtcgccgcggcgtgacgatggttacgacatcgccgattaccgt
ggtgtgcatccggaatacggcagcatggccgacgctcggcgcttcatcgccgaggcgcac
aagcgcgggttgcgggtgatcaccgaactggtcatcaaccacacgtccgaccagcacccc
tggttccagcgcgcgcgcaaggcgaagaagggctcggcagcgcgggatttctacgtctgg
tcggataccgacaagaagtacgacggcacacggatcatctttctcgacaccgagaaatcc
aactggacgtgggacccggtggccaagcagtacttctggcaccgcttctattcacaccag
ccggacctcaacttcgacaacccgcaggtgatgaaggccgtgttggcggtgatgcgctac
tggctggacatgggcatcgacggtctgcgccttgacgcgattccctatctggtcgagcgc
gacggcaccaacaacgagaacctgccggaaacccatgcggtgctcaaggcgatccgagcc
gagatcgacgccaactatcccgaccgcatgctgctggccgaagccaaccagtggccggaa
gacacccagctgtatttcggcggcgaagacggcgggccgggtgacgaatgccacatggcc
ttccacttcccgctgatgccgcgcatgtacatggcgatcgcccaggaggaccgcttcccg
atcaccgacatcctgcgccagaccccggacatcccggagaactgccagtgggcgatcttc
ctgcgcaaccacgatgagctgacgctggagatggtgaccgacaaggagcgcgactacctg
tggaactactacgcctcggacaagcgcgcacggatcaacctgggcatacgccggcgcctg
gcgccactgctggagcgtgatcgccggcggatcgagttgctcaacagcctgctgctctcc
atgcccggtacgccggtgatctactacggcgacgagatcggcatgggcgacaacatcttc
ctgggcgaccgcgacggcgtccgcacgccgatgcagtggtcggtggaccgcaacggcggt
ttctcccgcgccgacccaccgaacctggtgctgccgccggtgatggacccgctctacggc
tactacacgatcaacgtcgaggcccagcagcgcgatccgcattcgctgctcaactggacg
cggcggatgctgaccatccgcaagcagttcaaggccttcggccgtggcaccctgaagatg
ctcgcgccgagcaaccgccgcatcctcgcctacatgcgcgaattcaccggagcgaacggc
gaaaccgagatcattttctgcgtcgccaacgtctcgcgttcggcccaggccgcagaactg
gaaatgtcgcagtacgccggcatggtgccggtggagatggtcggcggcagtgccttcccg
cccatcggtcagctgccgtatctgctgaccttgccgcactacggcttctactggttccag
ctcgcgctgaccaaccagatgccgagctggcaccaggagccggtggacaccatgccggac
ttccagacgctggtactcaagcgcctggataccctgaccgccgccaaccggcgcattctg
gaaaccgaagcgctaccggcctatctgccgaaacggcgctggtttgccgccaaggacgtg
gcgatcgagtcggtccgcatcagctactgcgtgccattcggcgacccgaatcgcccggtt
ctgctcagcgagctttgtgtggaatccgccgggcgcagcgatctgtaccagctgccgctg
ggttttctggccgagaccgaattcgaggtcgcattgccgcagcaactggccctggcgcgg
gtacgccgcgggccgcaggtcggcctgatgaccgatgccttcgccctcgagcagttcagc
gccgcggtcattcagggcctgcgcgacgagctggtgctgccttgcaacgacggtgagatc
cgcttcgtgccgatgccgcaactggccgacctgcaattgccggcgcatcccgaggtgcgc
ttcatctctgcggagcagtcgaacagctcggcgatcatcgacaacaaggtgatgatcaaa
ttgctccgtcgcgtggcaccgggcgtccaccctgaactggaaatgggcggtttcctcact
gaacgcggtttcgcccatatctccggtatgctcggtcaggtcagccgcatcaacaagcag
ggcgagccggttgccctgatggtgatccagcatttcctcgacagccagggcgatgcctgg
gtgtggacgctgaacaacctcgaccgcgcggtgcgtgacgaaatcgcgggtggcgtgtcg
atgcacgagaaccagttcagcgccctcgacgaattgcaggccttcaaccgcctgctcggt
cagcggctcggcgagatgcacatggcgctggctacgcagaccgaagatccggccttcgcc
tacgaaagcaccagcacagccgacaccaagcagtgggagcaaagcgtcagtgcgcagctg
gagcaggccctgcagcgcctcgaggaacatcgctcgagcttcgatcgcaaggaggctacc
gcgctcggccaactgctggcgcggcgcgacaagctgctcgaacaagtgcaacgtctggct
gctagaaccgttggtggcgtgcggacccgtgtccacggcgacctgcacctcggccaggtg
ctggtggtgcagggtgatgcctacttcatcgacttcgaaggggagccggcccgctcgctg
gatgagcggcgcgccaaacatagtccgttcaaggatgtctcagggctgctgcgttcgttc
gagtacgccgccgccatgaccatccgcggtgcgcagatcagcgacagtacgcccgaggcc
gatcaggcgcggcagcgtatcgcggcgagttaccagagcagtgcgcaggcggccttcttc
gaagcctaccgcgaggccaccgccgagttgccgcacgactggcgcgacgcggatggcgcg
aatgctgcactgctgctgttcagcctggaaaaatgcgcttacgagattgtttacgaagcg
gagaaccgaccaacctggttgcccgtcccgctacagggattgctggccctggcacaacag
cttttcgatggaggctccaatgactga

DBGET integrated database retrieval system