KEGG   Pseudomonas stutzeri CCUG 29243: A458_12900Help
Entry
A458_12900        CDS       T02168                                 

Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00270  Cysteine and methionine metabolism
psc00330  Arginine and proline metabolism
psc00410  beta-Alanine metabolism
psc00480  Glutathione metabolism
psc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A458_12900
   00330 Arginine and proline metabolism
    A458_12900
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A458_12900
   00480 Glutathione metabolism
    A458_12900
Enzymes [BR:psc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     A458_12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 MTS Methyltransf_11 Methyltransf_31 Methyltransf_12 Cons_hypoth95 PP-binding_2 Methyltransf_30
Motif
Other DBs
NCBI-ProteinID: AFM33811
UniProt: I4CUQ4
LinkDB All DBs
Position
complement(2837039..2837899)
Genome map
AA seq 286 aa AA seqDB search
MSDFQETLYEGYGQRFQVDKLLHEVRTAHQHLVIFENPRMGRVMALDGVIQTSEADEFIY
HEMLAHVPILAHGLARRVLIIGGGDGGILREVARHRDIESITMVEIDATVVEMCREILPN
HSAGTFEDPRLNLVIDDGMRFVATTEEKFDVIISDSTDPIGPGEVLFSENFYQACRRCLN
EGGILVAQNGTPFMQLGELQTTARRMQGLFADWHFYQAAVPTYIGGAMSFAWGACSVESR
KLPLETLMQRFAGSGIVTRYYNPHVHLGAFALPQYVLHAIAKPSND
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactttcaggaaactctctacgagggatacgggcagcggttccaggtcgacaag
ctgctgcacgaggtgcgcaccgcgcatcagcatctggtgatcttcgagaacccgcgcatg
ggccgggtcatggccctggacggcgtgatccagaccagcgaagccgacgaattcatctac
cacgaaatgcttgcccacgtaccgatcctggcccatggactggcgcgtcgcgtgctgatc
atcggtggcggcgacggcggcatccttcgtgaagtggcgcgccaccgcgatatcgagagc
atcaccatggtcgagatcgatgccacggtggtggaaatgtgcagggagatcttgccgaac
cattccgccggcaccttcgaggatccgcggctgaatctggtgatcgacgacggcatgcgc
ttcgtggcgaccactgaagagaagttcgacgtcatcatctccgactccaccgatcccatc
ggcccaggtgaagtgttgttctctgagaacttctaccaggcctgtcgccgctgtctgaac
gaaggcggaatcctcgtcgcgcagaacggtacgccgttcatgcaactgggcgaactgcag
accactgccagacgcatgcaggggctgttcgccgactggcatttttaccaggcggctgtg
ccgacctatatcggtggtgccatgtccttcgcctggggcgcgtgcagcgtggagagccgc
aagctgccgctggaaaccctgatgcagcgcttcgccggcagcggcatcgttactcggtat
tacaacccgcatgtgcaccttggcgccttcgcactgccgcaatacgtgttgcatgcgatc
gccaagcccagcaacgactga

DBGET integrated database retrieval system