KEGG   Pseudomonas stutzeri CCUG 29243: A458_13135Help
Entry
A458_13135        CDS       T02168                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A458_13135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psc02000]
    A458_13135
Enzymes [BR:psc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A458_13135
Transporters [BR:psc02000]
 Other Transporters
  Pores ion channels [TC:1]
   A458_13135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AFM33858
UniProt: I4CUV1
LinkDB All DBs
Position
2881942..2882613
Genome map
AA seq 223 aa AA seqDB search
MITVHHLNHSRSHRVLWLLEELELLYELKRYPRDPKTMLAPAELKAVHPLGKSPVITDDD
LTLAESAAILEYLLERYGNGRLMPQGGTPEYRRFRYWMHYAEGSAMPPLLLRLVFDRVAN
GPMPFFVRPIARAIAKGANSAFIGPQLKTHLDYMEAELEKADWFAGNTFSAADIQMSFPL
EAARARAGLDESRPRLMDFLQRIQQRPAYKRAVERGGPALPTA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtccaccacttgaaccactcccgctcgcaccgcgtcctgtggctgctggaa
gaactggaactgctttacgagctgaagcgttaccctcgcgacccgaagaccatgctcgcg
ccagcagagctgaaagccgtacacccactgggcaagtctccggtgatcaccgacgacgac
ctgacgctggccgaatcggcagccatcctcgaatacctgctggaacgctatggcaacgga
cgcctgatgccgcagggcggcactccggaataccgtcgtttccgctactggatgcactac
gcggaaggctctgcgatgcccccactgttactgcggctggtattcgaccgcgtcgccaat
gggccgatgccgttctttgttcgccccatcgcacgcgcaatcgccaagggcgctaacagc
gccttcatcgggccacaactgaagacccatctcgattacatggaagcggaactggagaag
gccgactggtttgcaggcaacacgttcagcgcagcggatatacagatgagcttcccgctg
gaagctgcccgtgccagagctggcctggacgagagtcgcccacgcctgatggattttttg
cagcggatacagcagcggcccgcttacaaacgagccgtggagcgcggaggacccgccttg
cccaccgcgtag

DBGET integrated database retrieval system